HMGCLL1 (NM_001042406) Human Mass Spec Standard

CAT#: PH306162

HMGCLL1 MS Standard C13 and N15-labeled recombinant protein (NP_001035865)

Product Images

Coomassie blue staining of purified HMGCLL1 protein (Cat# TP306162). The protein was produced from HEK293T cells transfected with HMGCLL1 cDNA clone (Cat# RC206162) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206162
• Predicted MW: 36.3 kDa
• Protein Sequence:
  Sequence Link

  >RC206162 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGNVPSAVKHCLSYQQLLREHLWIGDSVAGALDPAQETSQLSGLPEFVKIVEVGPRDGLQNEKVIVPTDI
  KIEFINRLSQTGLSVIEVTSFVSSRWVPQMADHTEVMKGIHQYPGVRYPVLTPNLQGFHHAVAAGATEIS
  VFGAASESFSKKNINCSIEESMGKFEEVVKSARHMNIPARGYVSCALGCPYEGSITPQKVTEVSKRLYGM
  GCYEISLGDTIGVGTPGSMKRMLESVMKEIPPGALAVHCHDTYGQALANILTALQMGINVVDSAVSGLGG
  CPYAKGASGNVATEDLIYMLNGLGLNTGVNLYKVMEAGDFICKAVNKTTNSKVAQASFNA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001035865
• RefSeq Size: 2481
• RefSeq ORF: 1020
• Synonyms: bA418P12.1; er-cHL
• Locus ID: 54511
• UniProt ID: Q8TB92, Q9NT06, O95896
• Cytogenetics: 6p12.1
• Summary: Non-mitochondrial 3-hydroxymethyl-3-methylglutaryl-CoA lyase that catalyzes a cation-dependent cleavage of (S)-3-hydroxy-3-methylglutaryl-CoA into acetyl-CoA and acetoacetate, a key step in ketogenesis, the products of which support energy production in nonhepatic animal tissues.[UniProtKB/Swiss-Prot Function]