CCDC23 (SVBP) (NM_199342) Human Mass Spec Standard
CAT#: PH305925
CCDC23 MS Standard C13 and N15-labeled recombinant protein (NP_955374)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205925 |
Predicted MW | 7.6 kDa |
Protein Sequence |
>RC205925 representing NM_199342
Red=Cloning site Green=Tags(s) MDPPARKEKTKVKESVSRVEKAKQKSAQQELKQRQRAEIYALNRVMTELEQQQFDEFCKQMQPPGE myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_955374 |
RefSeq Size | 684 |
RefSeq ORF | 198 |
Synonyms | CCDC23; NEDAHM |
Locus ID | 374969 |
UniProt ID | Q8N300 |
Cytogenetics | 1p34.2 |
Summary | Enhances the tyrosine carboxypeptidase activity of VASH1 and VASH2, thereby promoting the removal of the C-terminal tyrosine residue of alpha-tubulin (PubMed:29146869). Also required to enhance the solubility and secretion of VASH1 and VASH2 (PubMed:20736312, PubMed:27879017).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403705 | CCDC23 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY403705 | Transient overexpression lysate of coiled-coil domain containing 23 (CCDC23) |
USD 436.00 |
|
TP305925 | Recombinant protein of human coiled-coil domain containing 23 (CCDC23), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review