CCDC23 (SVBP) (NM_199342) Human Mass Spec Standard

CAT#: PH305925

CCDC23 MS Standard C13 and N15-labeled recombinant protein (NP_955374)

Product Images

Coomassie blue staining of purified SVBP protein (Cat# TP305925). The protein was produced from HEK293T cells transfected with SVBP cDNA clone (Cat# RC205925) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205925
• Predicted MW: 7.6 kDa
• Protein Sequence:
  Sequence Link

  >RC205925 representing NM_199342
  Red=Cloning site Green=Tags(s)
  
  MDPPARKEKTKVKESVSRVEKAKQKSAQQELKQRQRAEIYALNRVMTELEQQQFDEFCKQMQPPGE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_955374
• RefSeq Size: 684
• RefSeq ORF: 198
• Synonyms: CCDC23; NEDAHM
• Locus ID: 374969
• UniProt ID: Q8N300
• Cytogenetics: 1p34.2
• Summary: Enhances the tyrosine carboxypeptidase activity of VASH1 and VASH2, thereby promoting the removal of the C-terminal tyrosine residue of alpha-tubulin (PubMed:29146869). Also required to enhance the solubility and secretion of VASH1 and VASH2 (PubMed:20736312, PubMed:27879017).[UniProtKB/Swiss-Prot Function]