RBP5 (NM_031491) Human Mass Spec Standard
CAT#: PH305891
RBP5 MS Standard C13 and N15-labeled recombinant protein (NP_113679)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205891 |
Predicted MW | 15.9 kDa |
Protein Sequence |
>RC205891 protein sequence
Red=Cloning site Green=Tags(s) MPPNLTGYYRFVSQKNMEDYLQALNISLAVRKIALLLKPDKEIEHQGNHMTVRTLSTFRNYTVQFDVGVE FEEDLRSVDGRKCQTIVTWEEEHLVCVQKGEVPNRGWRHWLEGEMLYLELTARDAVCEQVFRKVR myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_113679 |
RefSeq Size | 968 |
RefSeq ORF | 405 |
Synonyms | CRBP-III; CRBP3; CRBPIII; HRBPiso |
Locus ID | 83758 |
UniProt ID | P82980 |
Cytogenetics | 12p13.31 |
Summary | The protein encoded by this gene is a cellular retinol-binding protein expressed highly in kidney and liver. Down-regulation of the encoded protein in hepatocellular carcinoma was associated with large tumor size and poor patient survival rates. [provided by RefSeq, Jul 2016] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410487 | RBP5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY410487 | Transient overexpression lysate of retinol binding protein 5, cellular (RBP5) |
USD 436.00 |
|
TP305891 | Recombinant protein of human retinol binding protein 5, cellular (RBP5), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review