OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CYRIB (NM_016623) Human Mass Spec Standard

Be the first to review this product
SKU
PH305660
FAM49B MS Standard C13 and N15-labeled recombinant protein (NP_057707)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA331905 Rabbit Polyclonal Anti-FAM49B Antibody
100 ul
$585.00
LY413876 Transient overexpression lysate of family with sequence similarity 49, member B (FAM49B) (as WB positive control) 100 ug
$436.00

Other products for "CYRIB or NM_016623"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC205660
Predicted MW 36.7 kDa
Protein Sequence
Protein Sequence
>RC205660 protein sequence
Red=Cloning site Green=Tags(s)

MGNLLKVLTCTDLEQGPNFFLDFENAQPTESEKEIYNQVNVVLKDAEGILEDLQSYRGAGHEIREAIQHP
ADEKLQEKAWGAVVPLVGKLKKFYEFSQRLEAALRGLLGALTSTPYSPTQHLEREQALAKQFAEILHFTL
RFDELKMTNPAIQNDFSYYRRTLSRMRINNVPAEGENEVNNELANRMSLFYAEATPMLKTLSDATTKFVS
ENKNLPIENTTDCLSTMASVCRVMLETPEYRSRFTNEETVSFCLRVMVGVIILYDHVHPVGAFAKTSKID
MKGCIKVLKDQPPNSVEGLLNALRYTTKHLNDETTSKQIKSMLQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057707
RefSeq Size 3838
RefSeq ORF 972
Synonyms BM-009; CYRI; CYRI-B; FAM49B; L1
Locus ID 51571
UniProt ID Q9NUQ9
Cytogenetics 8q24.21
Summary Negatively regulates RAC1 signaling and RAC1-driven cytoskeletal remodeling (PubMed:31285585, PubMed:30250061). Regulates chemotaxis, cell migration and epithelial polarization by controlling the polarity, plasticity, duration and extent of protrusions. Limits Rac1 mediated activation of the Scar/WAVE complex, focuses protrusion signals and regulates pseudopod complexity by inhibiting Scar/WAVE-induced actin polymerization (PubMed:30250061). Protects against Salmonella bacterial infection. Attenuates processes such as macropinocytosis, phagocytosis and cell migration and restrict sopE-mediated bacterial entry (PubMed:31285585). Restricts also infection mediated by Mycobacterium tuberculosis and Listeria monocytogenes (By similarity). Involved in the regulation of mitochondrial dynamics and oxidative stress (PubMed:29059164).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CYRIB" proteins (3)
SKU Description Size Price
LC413876 Lyophilized FAM49B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413876 Transient overexpression lysate of family with sequence similarity 49, member B (FAM49B) (as WB positive control) 100 ug
$436.00
TP305660 Recombinant protein of human family with sequence similarity 49, member B (FAM49B), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products