CYRIB (NM_016623) Human Recombinant Protein

CAT#: TP305660M

Recombinant protein of human family with sequence similarity 49, member B (FAM49B), 100 µg

Product Images

Coomassie blue staining of purified FAM49B protein (Cat# TP305660). The protein was produced from HEK293T cells transfected with FAM49B cDNA clone (Cat# RC205660) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205660 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGNLLKVLTCTDLEQGPNFFLDFENAQPTESEKEIYNQVNVVLKDAEGILEDLQSYRGAGHEIREAIQHP
  ADEKLQEKAWGAVVPLVGKLKKFYEFSQRLEAALRGLLGALTSTPYSPTQHLEREQALAKQFAEILHFTL
  RFDELKMTNPAIQNDFSYYRRTLSRMRINNVPAEGENEVNNELANRMSLFYAEATPMLKTLSDATTKFVS
  ENKNLPIENTTDCLSTMASVCRVMLETPEYRSRFTNEETVSFCLRVMVGVIILYDHVHPVGAFAKTSKID
  MKGCIKVLKDQPPNSVEGLLNALRYTTKHLNDETTSKQIKSMLQ
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 36.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_057707
• Locus ID: 51571
• UniProt ID: Q9NUQ9, A0A024R9G4
• Cytogenetics: 8q24.21
• Refseq Size: 3838
• Refseq ORF: 972
• Synonyms: BM-009; CYRI; CYRI-B; FAM49B; L1
• Summary: Negatively regulates RAC1 signaling and RAC1-driven cytoskeletal remodeling (PubMed:31285585, PubMed:30250061). Regulates chemotaxis, cell migration and epithelial polarization by controlling the polarity, plasticity, duration and extent of protrusions. Limits Rac1 mediated activation of the Scar/WAVE complex, focuses protrusion signals and regulates pseudopod complexity by inhibiting Scar/WAVE-induced actin polymerization (PubMed:30250061). Protects against Salmonella bacterial infection. Attenuates processes such as macropinocytosis, phagocytosis and cell migration and restrict sopE-mediated bacterial entry (PubMed:31285585). Restricts also infection mediated by Mycobacterium tuberculosis and Listeria monocytogenes (By similarity). Involved in the regulation of mitochondrial dynamics and oxidative stress (PubMed:29059164).[UniProtKB/Swiss-Prot Function]