TMEM59 (NM_004872) Human Mass Spec Standard

CAT#: PH305624

TMEM59 MS Standard C13 and N15-labeled recombinant protein (NP_004863)

Product Images

Coomassie blue staining of purified TMEM59 protein (Cat# TP305624). The protein was produced from HEK293T cells transfected with TMEM59 cDNA clone (Cat# RC205624) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205624
• Predicted MW: 36.3 kDa
• Protein Sequence:
  Sequence Link

  >RC205624 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAPKGSLWVRTQLGLPPLLLLTMALAGGSGTASAEAFDSVLGDTASCHRACQLTYPLHTYPKEEELYAC
  QRGCRLFSICQFVDDGIDLNRTKLECESACTEAYSQSDEQYACHLGCQNQLPFAELRQEQLMSLMPKMHL
  LFPLTLVRSFWSDMMDSAQSFITSSWTFYLQADDGKIVIFQSKPEIQYAPHLEQEPTNLRESSLSKMSSD
  LQMRNSQAHRNFLEDGESDGFLRCLSLNSGWILTTTLVLSVMVLLWICCATVATAVEQYVPSEKLSIYGD
  LEFMNEQKLNRYPASSLVVVRSKTEDHEEAGPLPTKVNLAHSEI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004863
• RefSeq Size: 1709
• RefSeq ORF: 972
• Synonyms: C1orf8; DCF1; HSPC001; PRO195; UNQ169
• Locus ID: 9528
• UniProt ID: Q9BXS4
• Cytogenetics: 1p32.3
• Summary: This gene encodes a protein shown to regulate autophagy in response to bacterial infection. This protein may also regulate the retention of amyloid precursor protein (APP) in the Golgi apparatus through its control of APP glycosylation. Overexpression of this protein has been found to promote apoptosis in a glioma cell line. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2015]
• Protein Families: Transmembrane