OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RBJ (DNAJC27) (NM_016544) Human Mass Spec Standard

Be the first to review this product
SKU
PH305500
DNAJC27 MS Standard C13 and N15-labeled recombinant protein (NP_057628)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA811079 DNAJC27 mouse monoclonal antibody,clone OTI7A4 100 ul
$447.00
LY413917 Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily C, member 27 (DNAJC27) (as WB positive control) 100 ug
$436.00

Other products for "RBJ or NM_016544"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC205500
Predicted MW 30.9 kDa
Protein Sequence
Protein Sequence
>RC205500 protein sequence
Red=Cloning site Green=Tags(s)

MEANMPKRKEPGRSLRIKVISMGNAEVGKSCIIKRYCEKRFVSKYLATIGIDYGVTKVHVRDREIKVNIF
DMAGHPFFYEVRNEFYKDTQGVILVYDVGQKDSFDALDAWLAEMKQELGPHGNMENIIFVVCANKIDCTK
HRCVDESEGRLWAESKGFLYFETSAQTGEGINEMFQTFYISIVDLCENGGKRPTTNSSASFTKEQADAIR
RIRNSKDSWDMLGVKPGASRDEVNKAYRKLAVLLHPDKCVAPGSEDAFKAVVNARTALLKNIK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057628
RefSeq Size 5008
RefSeq ORF 819
Synonyms RabJS; RBJ
Locus ID 51277
UniProt ID Q9NZQ0
Cytogenetics 2p23.3
Summary GTPase which can activate the MEK/ERK pathway and induce cell transformation when overexpressed. May act as a nuclear scaffold for MAPK1, probably by association with MAPK1 nuclear export signal leading to enhanced ERK1/ERK2 signaling.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RBJ" proteins (5)
SKU Description Size Price
LC413917 Lyophilized DNAJC27 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC434021 Lyophilized DNAJC27 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413917 Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily C, member 27 (DNAJC27) (as WB positive control) 100 ug
$436.00
LY434021 Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily C, member 27 (DNAJC27), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP305500 Recombinant protein of human DnaJ (Hsp40) homolog, subfamily C, member 27 (DNAJC27), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products