DYDC1 (NM_138812) Human Mass Spec Standard
CAT#: PH305409
DYDC1 MS Standard C13 and N15-labeled recombinant protein (NP_620167)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205409 |
Predicted MW | 20.9 kDa |
Protein Sequence |
>RC205409 protein sequence
Red=Cloning site Green=Tags(s) MESIYLQKHLGACLTQGLAEVARVRPVDPIEYLALWIYKYKENVTMEQLRQKEMAKLERERELALMEQEM MERLKAEELLLQQQQLALQLELEMQEKERQRIQELQRAQEQLGKEMRMNMENLVRNEDILHSEEATLDSG KTLAEISDRYGAPNLSRVEELDEPMFSDIALNIDQDL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_620167 |
RefSeq Size | 787 |
RefSeq ORF | 531 |
Synonyms | DPY30D1 |
Locus ID | 143241 |
UniProt ID | Q8WWB3 |
Cytogenetics | 10q23.1 |
Summary | This gene encodes a member of a family of proteins that contains a DPY30 domain. The encoded protein is involved in acrosome formation during spermatid development. This gene locus overlaps with a closely related gene on the opposite strand. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2012] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408497 | DYDC1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY408497 | Transient overexpression lysate of DPY30 domain containing 1 (DYDC1) |
USD 436.00 |
|
TP305409 | Recombinant protein of human DPY30 domain containing 1 (DYDC1), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review