Monocarboxylic acid transporter 1 (SLC16A1) (NM_003051) Human Mass Spec Standard

CAT#: PH305213

SLC16A1 MS Standard C13 and N15-labeled recombinant protein (NP_003042)

Product Images

Coomassie blue staining of purified SLC16A1 protein (Cat# TP305213). The protein was produced from HEK293T cells transfected with SLC16A1 cDNA clone (Cat# RC205213) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205213
• Predicted MW: 53.9 kDa
• Protein Sequence:
  Sequence Link

  >RC205213 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPPAVGGPVGYTPPDGGWGWAVVIGAFISIGFSYAFPKSITVFFKEIEGIFHATTSEVSWISSIMLAVMY
  GGGPISSILVNKYGSRIVMIVGGCLSGCGLIAASFCNTVQQLYVCIGVIGGLGLAFNLNPALTMIGKYFY
  KRRPLANGLAMAGSPVFLCTLAPLNQVFFGIFGWRGSFLILGGLLLNCCVAGALMRPIGPKPTKAGKDKS
  KASLEKAGKSGVKKDLHDANTDLIGRHPKQEKRSVFQTINQFLDLTLFTHRGFLLYLSGNVIMFFGLFAP
  LVFLSSYGKSQHYSSEKSAFLLSILAFVDMVARPSMGLVANTKPIRPRIQYFFAASVVANGVCHMLAPLS
  TTYVGFCVYAGFFGFAFGWLSSVLFETLMDLVGPQRFSSAVGLVTIVECCPVLLGPPLLGRLNDMYGDYK
  YTYWACGVVLIISGIYLFIGMGINYRLLAKEQKANEQKKESKEEETSIDVAGKPNEVTKAAESPDQKDTD
  GGPKEEESPV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003042
• RefSeq Size: 3927
• RefSeq ORF: 1500
• Synonyms: HHF7; MCT; MCT1; MCT1D
• Locus ID: 6566
• UniProt ID: P53985, A0A024R0H1
• Cytogenetics: 1p13.2
• Summary: The protein encoded by this gene is a proton-linked monocarboxylate transporter that catalyzes the movement of many monocarboxylates, such as lactate and pyruvate, across the plasma membrane. Mutations in this gene are associated with erythrocyte lactate transporter defect. Alternatively spliced transcript variants have been found for this gene.[provided by RefSeq, Oct 2009]
• Protein Families: Transmembrane