PTS (NM_000317) Human Mass Spec Standard

CAT#: PH305199

PTS MS Standard C13 and N15-labeled recombinant protein (NP_000308)

Product Images

Coomassie blue staining of purified PTS protein (Cat# TP305199). The protein was produced from HEK293T cells transfected with PTS cDNA clone (Cat# RC205199) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205199
• Predicted MW: 16.4 kDa
• Protein Sequence:
  Sequence Link

  >RC205199 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSTEGGGRRCQAQVSRRISFSASHRLYSKFLSDEENLKLFGKCNNPNGHGHNYKVVVTVHGEIDPATGMV
  MNLADLKKYMEEAIMQPLDHKNLDMDVPYFADVVSTTENVAVYMWDNLQKVLPVGVLYKVKVYETDNNIV
  VYKGE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_000308
• RefSeq Size: 948
• RefSeq ORF: 435
• Synonyms: PTPS
• Locus ID: 5805
• UniProt ID: Q03393
• Cytogenetics: 11q23.1
• Summary: The enzyme encoded by this gene catalyzes the elimination of inorganic triphosphate from dihydroneopterin triphosphate, which is the second and irreversible step in the biosynthesis of tetrahydrobiopterin from GTP. Tetrahydrobiopterin, also known as BH(4), is an essential cofactor and regulator of various enzyme activities, including enzymes involved in serotonin biosynthesis and NO synthase activity. Mutations in this gene result in hyperphenylalaninemia. [provided by RefSeq, Oct 2008]
• Protein Families: Druggable Genome
• Protein Pathways: Folate biosynthesis, Metabolic pathways