C1orf150 (GCSAML) (NM_145278) Human Mass Spec Standard
CAT#: PH305104
C1orf150 MS Standard C13 and N15-labeled recombinant protein (NP_660321)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205104 |
Predicted MW | 15.7 kDa |
Protein Sequence |
>RC205104 protein sequence
Red=Cloning site Green=Tags(s) MGNYLLRKLSCLGENQKKPKKGNPDEERKRQEMTTFERKLQDQDKKSQEVSSTSNQENENGSGSEEVCYT VINHIPHQRSSLSSNDDGYENIDSLTRKVRQFRERSETEYALLRTSVSRPCSCTHEHDYEVVFPH myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_660321 |
RefSeq Size | 3863 |
RefSeq ORF | 405 |
Synonyms | C1orf150 |
Locus ID | 148823 |
UniProt ID | Q5JQS6, Q6ZVI8 |
Cytogenetics | 1q44 |
Summary | This gene encodes a protein thought to be a signaling molecule associated with germinal centers, the sites of proliferation and differentiation of mature B lymphocytes. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408002 | GCSAML HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY408002 | Transient overexpression lysate of chromosome 1 open reading frame 150 (C1orf150) |
USD 436.00 |
|
TP305104 | Recombinant protein of human chromosome 1 open reading frame 150 (C1orf150), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review