Stathmin 1 (STMN1) (NM_203401) Human Mass Spec Standard

CAT#: PH305073

STMN1 MS Standard C13 and N15-labeled recombinant protein (NP_981946)

Product Images

Coomassie blue staining of purified STMN1 protein (Cat# TP305073). The protein was produced from HEK293T cells transfected with STMN1 cDNA clone (Cat# RC205073) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205073
• Predicted MW: 17.1 kDa
• Protein Sequence:
  Sequence Link

  >RC205073 representing NM_203401
  Red=Cloning site Green=Tags(s)
  
  MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDFSLEEIQKKLEAAEERRKSHEAEVLK
  QLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESK
  DPADETEAD
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_981946
• RefSeq Size: 1730
• RefSeq ORF: 447
• Synonyms: C1orf215; Lag; LAP18; OP18; PP17; PP19; PR22; SMN
• Locus ID: 3925
• UniProt ID: P16949
• Cytogenetics: 1p36.11
• Summary: This gene belongs to the stathmin family of genes. It encodes a ubiquitous cytosolic phosphoprotein proposed to function as an intracellular relay integrating regulatory signals of the cellular environment. The encoded protein is involved in the regulation of the microtubule filament system by destabilizing microtubules. It prevents assembly and promotes disassembly of microtubules. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2009]
• Protein Pathways: MAPK signaling pathway