Tbp7 (PSMC4) (NM_006503) Human Mass Spec Standard
CAT#: PH304932
PSMC4 MS Standard C13 and N15-labeled recombinant protein (NP_006494)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204932 |
Predicted MW | 47.4 kDa |
Protein Sequence |
>RC204932 protein sequence
Red=Cloning site Green=Tags(s) MEEIGILVEKAQDEIPALSVSRPQTGLSFLGPEPEDLEDLYSRYKKLQQELEFLEVQEEYIKDEQKNLKK EFLHAQEEVKRIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTIDRELLKPNASVALHKHSNALV DVLPPEADSSIMMLTSDQKPDVMYADIGGMDIQKQEVREAVELPLTHFELYKQIGIDPPRGVLMYGPPGC GKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDAQTG ADREVQRILLELLNQMDGFDQNVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLIFSTITS KMNLSEEVDLEDYVARPDKISGADINSICQESGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_006494 |
RefSeq Size | 1914 |
RefSeq ORF | 1254 |
Synonyms | MIP224; RPT3; S6; TBP-7; TBP7 |
Locus ID | 5704 |
UniProt ID | P43686, A8K2M0 |
Cytogenetics | 19q13.2 |
Summary | The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. This gene encodes a member of the triple-A family of ATPases that is a component of the 19S regulatory subunit and plays a role in 26S proteasome assembly. The encoded protein interacts with gankyrin, a liver oncoprotein, and may also play a role in Parkinson's disease through interactions with synphilin-1. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jul 2012] |
Protein Families | Druggable Genome |
Protein Pathways | Proteasome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401949 | PSMC4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC407188 | PSMC4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY401949 | Transient overexpression lysate of proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4), transcript variant 1 |
USD 436.00 |
|
LY407188 | Transient overexpression lysate of proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4), transcript variant 2 |
USD 436.00 |
|
TP304932 | Recombinant protein of human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4), transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review