TIMM8A (NM_004085) Human Mass Spec Standard

CAT#: PH304771

TIMM8A MS Standard C13 and N15-labeled recombinant protein (NP_004076)

Product Images

Coomassie blue staining of purified TIMM8A protein (Cat# TP304771). The protein was produced from HEK293T cells transfected with TIMM8A cDNA clone (Cat# RC204771) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204771
• Predicted MW: 11 kDa
• Protein Sequence:
  Sequence Link

  >RC204771 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDSSSSSSAAGLGAVDPQLQHFIEVETQKQRFQQLVHQMTELCWEKCMDKPGPKLDSRAEACFVNCVERF
  IDTSQFILNRLEQTQKSKPVFSESLSD
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004076
• RefSeq Size: 1459
• RefSeq ORF: 291
• Synonyms: DDP; DDP1; DFN1; MTS; TIM8
• Locus ID: 1678
• UniProt ID: O60220
• Cytogenetics: Xq22.1
• Summary: This translocase is involved in the import and insertion of hydrophobic membrane proteins from the cytoplasm into the mitochondrial inner membrane. The gene is mutated in Mohr-Tranebjaerg syndrome/Deafness Dystonia Syndrome (MTS/DDS) and it is postulated that MTS/DDS is a mitochondrial disease caused by a defective mitochondrial protein import system. Defects in this gene also cause Jensen syndrome; an X-linked disease with opticoacoustic nerve atrophy and muscle weakness. This protein, along with TIMM13, forms a 70 kDa heterohexamer. Alternative splicing results in multiple transcript variants encoding distinct isoforms.[provided by RefSeq, Mar 2009]
• Protein Families: Druggable Genome