CEP20 (NM_144600) Human Mass Spec Standard

CAT#: PH304756

C16orf63 MS Standard C13 and N15-labeled recombinant protein (NP_653201)

Product Images

Coomassie blue staining of purified FOPNL protein (Cat# TP304756). The protein was produced from HEK293T cells transfected with FOPNL cDNA clone (Cat# RC204756) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204756
• Predicted MW: 19.8 kDa
• Protein Sequence:
  Sequence Link

  >RC204756 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MATVAELKAVLKDTLEKKGVLGHLKARIRAEVFNALDDDREPRPSLSHENLLINELIREYLEFNKYKYTA
  SVLIAESGQPVVPLDRQFLIHELNAFEESKDNTIPLLYGILAHFLRGTKDGIQNAFLKGPSLQPSDPSLG
  RQPSRRKPMDDHLRKEEQKSTNIEDLHVSQAVNR
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_653201
• RefSeq Size: 2250
• RefSeq ORF: 522
• Synonyms: C16orf63; FOPNL; FOR20; PHSECRG2
• Locus ID: 123811
• UniProt ID: Q96NB1
• Cytogenetics: 16p13.11
• Summary: Involved in the biogenesis of cilia (PubMed:20551181). Required for the recruitement of PLK1 to centrosomes and S phase progression (PubMed:24018379).[UniProtKB/Swiss-Prot Function]