Pancreatic Lipase (PNLIP) (NM_000936) Human Mass Spec Standard

CAT#: PH304735

PNLIP MS Standard C13 and N15-labeled recombinant protein (NP_000927)

Product Images

Coomassie blue staining of purified PNLIP protein (Cat# TP304735). The protein was produced from HEK293T cells transfected with PNLIP cDNA clone (Cat# RC204735) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204735
• Predicted MW: 51.2 kDa
• Protein Sequence:
  Sequence Link

  >RC204735 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLPLWTLSLLLGAVAGKEVCYERLGCFSDDSPWSGITERPLHILPWSPKDVNTRFLLYTNENPNNFQEVA
  ADSSSISGSNFKTNRKTRFIIHGFIDKGEENWLANVCKNLFKVESVNCICVDWKGGSRTGYTQASQNIRI
  VGAEVAYFVEFLQSAFGYSPSNVHVIGHSLGAHAAGEAGRRTNGTIGRITGLDPAEPCFQGTPELVRLDP
  SDAKFVDVIHTDGAPIVPNLGFGMSQVVGHLDFFPNGGVEMPGCKKNILSQIVDIDGIWEGTRDFAACNH
  LRSYKYYTDSIVNPDGFAGFPCASYNVFTANKCFPCPSGGCPQMGHYADRYPGKTNDVGQKFYLDTGDAS
  NFARWRYKVSVTLSGKKVTGHILVSLFGNKGNSKQYEIFKGTLKPDSTHSNEFDSDVDVGDLQMVKFIWY
  NNVINPTLPRVGASKIIVETNVGKQFNFCSPETVREEVLLTLTPC
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_000927
• RefSeq Size: 1502
• RefSeq ORF: 1395
• Synonyms: PL; PNLIPD; PTL
• Locus ID: 5406
• UniProt ID: P16233
• Cytogenetics: 10q25.3
• Summary: This gene encodes a member of the lipase family of proteins. The encoded enzyme is secreted by the pancreas and hydrolyzes triglycerides in the small intestine, and is essential for the efficient digestion of dietary fats. Inhibition of the encoded enzyme may prevent high-fat diet-induced obesity in mice and result in weight loss in human patients with obesity. Mutations in this gene cause congenital pancreatic lipase deficiency, a rare disorder characterized by steatorrhea. [provided by RefSeq, Jul 2016]
• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: Glycerolipid metabolism, Metabolic pathways