Pancreatic Lipase (PNLIP) (NM_000936) Human Recombinant Protein

CAT#: TP304735

Recombinant protein of human pancreatic lipase (PNLIP), 20 µg

Product Images

Coomassie blue staining of purified PNLIP protein (Cat# TP304735). The protein was produced from HEK293T cells transfected with PNLIP cDNA clone (Cat# RC204735) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204735 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLPLWTLSLLLGAVAGKEVCYERLGCFSDDSPWSGITERPLHILPWSPKDVNTRFLLYTNENPNNFQEVA
  ADSSSISGSNFKTNRKTRFIIHGFIDKGEENWLANVCKNLFKVESVNCICVDWKGGSRTGYTQASQNIRI
  VGAEVAYFVEFLQSAFGYSPSNVHVIGHSLGAHAAGEAGRRTNGTIGRITGLDPAEPCFQGTPELVRLDP
  SDAKFVDVIHTDGAPIVPNLGFGMSQVVGHLDFFPNGGVEMPGCKKNILSQIVDIDGIWEGTRDFAACNH
  LRSYKYYTDSIVNPDGFAGFPCASYNVFTANKCFPCPSGGCPQMGHYADRYPGKTNDVGQKFYLDTGDAS
  NFARWRYKVSVTLSGKKVTGHILVSLFGNKGNSKQYEIFKGTLKPDSTHSNEFDSDVDVGDLQMVKFIWY
  NNVINPTLPRVGASKIIVETNVGKQFNFCSPETVREEVLLTLTPC
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 49.5 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_000927
• Locus ID: 5406
• UniProt ID: P16233
• Cytogenetics: 10q25.3
• Refseq Size: 1502
• Refseq ORF: 1395
• Synonyms: PL; PNLIPD; PTL
• Summary: This gene encodes a member of the lipase family of proteins. The encoded enzyme is secreted by the pancreas and hydrolyzes triglycerides in the small intestine, and is essential for the efficient digestion of dietary fats. Inhibition of the encoded enzyme may prevent high-fat diet-induced obesity in mice and result in weight loss in human patients with obesity. Mutations in this gene cause congenital pancreatic lipase deficiency, a rare disorder characterized by steatorrhea. [provided by RefSeq, Jul 2016]
• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: Glycerolipid metabolism, Metabolic pathways