Hemoglobin subunit gamma 2 (HBG2) (NM_000184) Human Mass Spec Standard

CAT#: PH304709

HBG2 MS Standard C13 and N15-labeled recombinant protein (NP_000175)

Product Images

Coomassie blue staining of purified HBG2 protein (Cat# TP304709). The protein was produced from HEK293T cells transfected with HBG2 cDNA clone (Cat# RC204709) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204709
• Predicted MW: 16.1 kDa
• Protein Sequence:
  Sequence Link

  >RC204709 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVLT
  SLGDAIKHLDDLKGTFAQLSELHCDKLHVDPENFKLLGNVLVTVLAIHFGKEFTPEVQASWQKMVTAVAS
  ALSSRYH
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_000175
• RefSeq Size: 583
• RefSeq ORF: 441
• Synonyms: HBG-T1; TNCY
• Locus ID: 3048
• UniProt ID: P69892, D9YZU9
• Cytogenetics: 11p15.4
• Summary: The gamma globin genes (HBG1 and HBG2) are normally expressed in the fetal liver, spleen and bone marrow. Two gamma chains together with two alpha chains constitute fetal hemoglobin (HbF) which is normally replaced by adult hemoglobin (HbA) at birth. In some beta-thalassemias and related conditions, gamma chain production continues into adulthood. The two types of gamma chains differ at residue 136 where glycine is found in the G-gamma product (HBG2) and alanine is found in the A-gamma product (HBG1). The former is predominant at birth. The order of the genes in the beta-globin cluster is: 5'- epsilon -- gamma-G -- gamma-A -- delta -- beta--3'. [provided by RefSeq, Jul 2008]