IDI2 (NM_033261) Human Mass Spec Standard
CAT#: PH304632
IDI2 MS Standard C13 and N15-labeled recombinant protein (NP_150286)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204632 |
Predicted MW | 26.8 kDa |
Protein Sequence |
>RC204632 protein sequence
Red=Cloning site Green=Tags(s) MSDINLDWVDRRQLQRLEEMLIVVDENDKVIGADTKRNCHLNENIEKGLLHRAFSVVLFNTKNRILIQQR SDTKVTFPGYFTDSCSSHPLYNPAELEEKDAIGVRRAAQRRLQAELGIPGEQISPEDIVFMTIYHHKAKS DRIWGEHEICYLLLVRKNVTLNPDPSETKSILYLSQEELWELLEREARGEVKVTPWLRTIAERFLYRWWP HLDDVTPFVELHKIHRV myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_150286 |
RefSeq Size | 1359 |
RefSeq ORF | 681 |
Synonyms | IPPI2 |
Locus ID | 91734 |
UniProt ID | Q9BXS1 |
Cytogenetics | 10p15.3 |
Summary | The protein encoded by this gene catalyzes the conversion of isopentenyl diphosphate to dimethylallyl diphosphate, which is a precursor for the synthesis of cholesterol and other isoprenoids. This gene, which is a product of an ancestral gene duplication event, encodes a protein that may be involved in the aggregation of alpha-synuclein in the cerebral cortex of patients with Lewy body disease. In addition, segmental copy number gains in this locus have been associated with sporadic amyotrophic lateral sclerosis. [provided by RefSeq, Jul 2016] |
Protein Pathways | Metabolic pathways, Terpenoid backbone biosynthesis |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409635 | IDI2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY409635 | Transient overexpression lysate of isopentenyl-diphosphate delta isomerase 2 (IDI2) |
USD 436.00 |
|
TP304632 | Recombinant protein of human isopentenyl-diphosphate delta isomerase 2 (IDI2), 20 µg |
USD 867.00 |
|
TP720549 | Recombinant protein of human isopentenyl-diphosphate delta isomerase 2 (IDI2) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review