OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

IDI2 (NM_033261) Human Mass Spec Standard

Be the first to review this product
SKU
PH304632
IDI2 MS Standard C13 and N15-labeled recombinant protein (NP_150286)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA370956 IDI2 rabbit polyclonal antibody
100 ul
$310.00
LY409635 Transient overexpression lysate of isopentenyl-diphosphate delta isomerase 2 (IDI2) (as WB positive control) 100 ug
$436.00

Other products for "IDI2 or NM_033261"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204632
Predicted MW 26.8 kDa
Protein Sequence
Protein Sequence
>RC204632 protein sequence
Red=Cloning site Green=Tags(s)

MSDINLDWVDRRQLQRLEEMLIVVDENDKVIGADTKRNCHLNENIEKGLLHRAFSVVLFNTKNRILIQQR
SDTKVTFPGYFTDSCSSHPLYNPAELEEKDAIGVRRAAQRRLQAELGIPGEQISPEDIVFMTIYHHKAKS
DRIWGEHEICYLLLVRKNVTLNPDPSETKSILYLSQEELWELLEREARGEVKVTPWLRTIAERFLYRWWP
HLDDVTPFVELHKIHRV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_150286
RefSeq Size 1359
RefSeq ORF 681
Synonyms IPPI2
Locus ID 91734
UniProt ID Q9BXS1
Cytogenetics 10p15.3
Summary The protein encoded by this gene catalyzes the conversion of isopentenyl diphosphate to dimethylallyl diphosphate, which is a precursor for the synthesis of cholesterol and other isoprenoids. This gene, which is a product of an ancestral gene duplication event, encodes a protein that may be involved in the aggregation of alpha-synuclein in the cerebral cortex of patients with Lewy body disease. In addition, segmental copy number gains in this locus have been associated with sporadic amyotrophic lateral sclerosis. provided by RefSeq, Jul 2016
Protein Pathways Metabolic pathways, Terpenoid backbone biosynthesis
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "IDI2" proteins (4)
SKU Description Size Price
LC409635 Lyophilized IDI2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY409635 Transient overexpression lysate of isopentenyl-diphosphate delta isomerase 2 (IDI2) (as WB positive control) 100 ug
$436.00
TP304632 Recombinant protein of human isopentenyl-diphosphate delta isomerase 2 (IDI2), 20 µg 20 ug
$737.00
TP720549 Recombinant protein of human isopentenyl-diphosphate delta isomerase 2 (IDI2) 10 ug
$340.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products