IDI2 (NM_033261) Human Mass Spec Standard

CAT#: PH304632

IDI2 MS Standard C13 and N15-labeled recombinant protein (NP_150286)

Product Images

Coomassie blue staining of purified IDI2 protein (Cat# TP304632). The protein was produced from HEK293T cells transfected with IDI2 cDNA clone (Cat# RC204632) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204632
• Predicted MW: 26.8 kDa
• Protein Sequence:
  Sequence Link

  >RC204632 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSDINLDWVDRRQLQRLEEMLIVVDENDKVIGADTKRNCHLNENIEKGLLHRAFSVVLFNTKNRILIQQR
  SDTKVTFPGYFTDSCSSHPLYNPAELEEKDAIGVRRAAQRRLQAELGIPGEQISPEDIVFMTIYHHKAKS
  DRIWGEHEICYLLLVRKNVTLNPDPSETKSILYLSQEELWELLEREARGEVKVTPWLRTIAERFLYRWWP
  HLDDVTPFVELHKIHRV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_150286
• RefSeq Size: 1359
• RefSeq ORF: 681
• Synonyms: IPPI2
• Locus ID: 91734
• UniProt ID: Q9BXS1
• Cytogenetics: 10p15.3
• Summary: The protein encoded by this gene catalyzes the conversion of isopentenyl diphosphate to dimethylallyl diphosphate, which is a precursor for the synthesis of cholesterol and other isoprenoids. This gene, which is a product of an ancestral gene duplication event, encodes a protein that may be involved in the aggregation of alpha-synuclein in the cerebral cortex of patients with Lewy body disease. In addition, segmental copy number gains in this locus have been associated with sporadic amyotrophic lateral sclerosis. [provided by RefSeq, Jul 2016]
• Protein Pathways: Metabolic pathways, Terpenoid backbone biosynthesis