HNF1 beta (HNF1B) (NM_000458) Human Mass Spec Standard

CAT#: PH304453

HNF1B MS Standard C13 and N15-labeled recombinant protein (NP_000449)

Product Images

Coomassie blue staining of purified HNF1B protein (Cat# TP304453). The protein was produced from HEK293T cells transfected with HNF1B cDNA clone (Cat# RC204453) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204453
• Predicted MW: 61.3 kDa
• Protein Sequence:
  Sequence Link

  >RC204453 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVSKLTSLQQELLSALLSSGVTKEVLVQALEELLPSPNFGVKLETLPLSPGSGAEPDTKPVFHTLTNGHA
  KGRLSGDEGSEDGDDYDTPPILKELQALNTEEAAEQRAEVDRMLSEDPWRAAKMIKGYMQQHNIPQREVV
  DVTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREILRQFNQTVQSSGNMTDKSSQDQLLFLFPEFS
  QQSHGPGQSDDACSEPTNKKMRRNRFKWGPASQQILYQAYDRQKNPSKEEREALVEECNRAECLQRGVSP
  SKAHGLGSNLVTEVRVYNWFANRRKEEAFRQKLAMDAYSSNQTHSLNPLLSHGSPHHQPSSSPPNKLSGV
  RYSQQGNNEITSSSTISHHGNSAMVTSQSVLQQVSPASLDPGHNLLSPDGKMISVSGGGLPPVSTLTNIH
  SLSHHNPQQSQNLIMTPLSGVMAIAQSLNTSQAQSVPVINSVAGSLAALQPVQFSQQLHSPHQQPLMQQS
  PGSHMAQQPFMAAVTQLQNSHMYAHKQEPPQYSHTSRFPSAMVVTDTSSISTLTNMSSSKQCPLQAW
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_000449
• RefSeq Size: 2842
• RefSeq ORF: 1671
• Synonyms: ADTKD3; FJHN; HNF-1-beta; HNF-1B; HNF1beta; HNF2; HPC11; LF-B3; LFB3; MODY5; RCAD; T2D; TCF-2; TCF2; VHNF1
• Locus ID: 6928
• UniProt ID: P35680, Q6FHW6
• Cytogenetics: 17q12
• Summary: This gene encodes a member of the homeodomain-containing superfamily of transcription factors. The protein binds to DNA as either a homodimer, or a heterodimer with the related protein hepatocyte nuclear factor 1-alpha. The gene has been shown to function in nephron development, and regulates development of the embryonic pancreas. Mutations in this gene result in renal cysts and diabetes syndrome and noninsulin-dependent diabetes mellitus, and expression of this gene is altered in some types of cancer. Multiple transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Sep 2009]
• Protein Families: Druggable Genome, Embryonic stem cells, ES Cell Differentiation/IPS, Transcription Factors
• Protein Pathways: Maturity onset diabetes of the young