CDK2AP1 (NM_004642) Human Mass Spec Standard
CAT#: PH304442
CDK2AP1 MS Standard C13 and N15-labeled recombinant protein (NP_004633)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204442 |
Predicted MW | 12.4 kDa |
Protein Sequence |
>RC204442 protein sequence
Red=Cloning site Green=Tags(s) MSYKPNLAAHMPAAALNAAGSVHSPSTSMATSSQYRQLLSDYGPPSLGYTQGTGNSQVPQSKYAELLAII EELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_004633 |
RefSeq Size | 1655 |
RefSeq ORF | 345 |
Synonyms | doc-1; DOC1; DORC1; p12DOC-1; ST19 |
Locus ID | 8099 |
UniProt ID | O14519 |
Cytogenetics | 12q24.31 |
Summary | The protein encoded by this gene is a cyclin-dependent kinase 2 (CDK2) -associated protein which is thought to negatively regulate CDK2 activity by sequestering monomeric CDK2, and targeting CDK2 for proteolysis. This protein was found to also interact with DNA polymerase alpha/primase and mediate the phosphorylation of the large p180 subunit, which suggests a regulatory role in DNA replication during the S-phase of the cell cycle. This protein also forms a core subunit of the nucleosome remodeling and histone deacetylation (NURD) complex that epigenetically regulates embryonic stem cell differentiation. This gene thus plays a role in both cell-cycle and epigenetic regulation. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2012] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401472 | CDK2AP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY401472 | Transient overexpression lysate of cyclin-dependent kinase 2 associated protein 1 (CDK2AP1) |
USD 436.00 |
|
TP304442 | Recombinant protein of human cyclin-dependent kinase 2 associated protein 1 (CDK2AP1), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review