SGK3 (NM_013257) Human Mass Spec Standard
CAT#: PH304416
SGK3 MS Standard C13 and N15-labeled recombinant protein (NP_037389)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204416 |
Predicted MW | 57.1 kDa |
Protein Sequence |
>RC204416 protein sequence
Red=Cloning site Green=Tags(s) MQRDHTMDYKESCPSVSIPSSDEHREKKKRFTVYKVLVSVGRSEWFVFRRYAEFDKLYNTLKKQFPAMAL KIPAKRIFGDNFDPDFIKQRRAGLNEFIQNLVRYPELYNHPDVRAFLQMDSPKHQSDPSEDEDERSSQKL HSTSQNINLGPSGNPHAKPTDFDFLKVIGKGSFGKVLLAKRKLDGKFYAVKVLQKKIVLNRKEQKHIMAE RNVLLKNVKHPFLVGLHYSFQTTEKLYFVLDFVNGGELFFHLQRERSFPEHRARFYAAEIASALGYLHSI KIVYRDLKPENILLDSVGHVVLTDFGLCKEGIAISDTTTTFCGTPEYLAPEVIRKQPYDNTVDWWCLGAV LYEMLYGLPPFYCRDVAEMYDNILHKPLSLRPGVSLTAWSILEELLEKDRQNRLGAKEDFLEIQNHPFFE SLSWADLVQKKIPPPFNPNVAGPDDIRNFDTAFTEETVPYSVCVSSDYSIVNASVLEADDAFVGFSYAPP SEDLFL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_037389 |
RefSeq Size | 4206 |
RefSeq ORF | 1488 |
Synonyms | CISK; SGK2; SGKL |
Locus ID | 23678 |
UniProt ID | Q96BR1, A0A024R807, Q53EW6, Q5H9Q5 |
Cytogenetics | 8q13.1 |
Summary | This gene is a member of the Ser/Thr protein kinase family and encodes a phosphoprotein with a PX (phox homology) domain. The protein phosphorylates several target proteins and has a role in neutral amino acid transport and activation of potassium and chloride channels. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Protein Kinase |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406888 | SGK3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC415716 | SGK3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC422403 | SGK3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LY406888 | Transient overexpression lysate of serum/glucocorticoid regulated kinase family, member 3 (SGK3), transcript variant 2 |
USD 665.00 |
|
LY415716 | Transient overexpression lysate of serum/glucocorticoid regulated kinase family, member 3 (SGK3), transcript variant 1 |
USD 436.00 |
|
LY422403 | Transient overexpression lysate of serum/glucocorticoid regulated kinase family, member 3 (SGK3), transcript variant 3 |
USD 665.00 |
|
TP304416 | Recombinant protein of human serum/glucocorticoid regulated kinase family, member 3 (SGK3), transcript variant 1, 20 µg |
USD 867.00 |
|
TP760266 | Recombinant protein of human serum/glucocorticoid regulated kinase family, member 3 (SGK3), transcript variant 3, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
USD 261.00 |
{0} Product Review(s)
Be the first one to submit a review