PP1C gamma (PPP1CC) (NM_002710) Human Mass Spec Standard
CAT#: PH304158
PPP1CC MS Standard C13 and N15-labeled recombinant protein (NP_002701)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204158 |
Predicted MW | 37 kDa |
Protein Sequence |
>RC204158 protein sequence
Red=Cloning site Green=Tags(s) MADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYY DLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDEC KRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPD KDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAG AMMSVDETLMCSFQILKPAEKKKPNATRPVTPPRGMITKQAKK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_002701 |
RefSeq Size | 2526 |
RefSeq ORF | 969 |
Synonyms | PP-1G; PP1C; PPP1G |
Locus ID | 5501 |
UniProt ID | P36873, A0A024RBP2 |
Cytogenetics | 12q24.11 |
Summary | The protein encoded by this gene belongs to the protein phosphatase family, PP1 subfamily. PP1 is an ubiquitous serine/threonine phosphatase that regulates many cellular processes, including cell division. It is expressed in mammalian cells as three closely related isoforms, alpha, beta/delta and gamma, which have distinct localization patterns. This gene encodes the gamma isozyme. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011] |
Protein Families | Druggable Genome, Phosphatase |
Protein Pathways | Focal adhesion, Insulin signaling pathway, Long-term potentiation, Oocyte meiosis, Regulation of actin cytoskeleton, Vascular smooth muscle contraction |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419153 | PPP1CC HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY419153 | Transient overexpression lysate of protein phosphatase 1, catalytic subunit, gamma isoform (PPP1CC) |
USD 436.00 |
|
TP304158 | Recombinant protein of human protein phosphatase 1, catalytic subunit, gamma isoform (PPP1CC), 20 µg |
USD 867.00 |
|
TP720571 | Recombinant protein of human protein phosphatase 1, catalytic subunit, gamma isoform (PPP1CC) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review