FBXL8 (NM_018378) Human Mass Spec Standard

CAT#: PH304109

FBXL8 MS Standard C13 and N15-labeled recombinant protein (NP_060848)

Product Images

Coomassie blue staining of purified FBXL8 protein (Cat# TP304109). The protein was produced from HEK293T cells transfected with FBXL8 cDNA clone (Cat# RC204109) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204109
• Predicted MW: 40.5 kDa
• Protein Sequence:
  Sequence Link

  >RC204109 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAEPGEGLPEEVLALIFRHLSLRDRAAAARVCRAWAAAATCSAVWHDTKISCECELEGMLPPYLSACLDH
  IHNLRLEFEPSRKPSRRAAIELLMVLAGRAPGLRGLRLECRGEKPLFDAGRDVLEAVHAVCGAASQLRHL
  DLRRLSFTLDDALVLQAARSCPELHSLFLDNSTLVGSVGPGSVLELLEACPRLRALGLHLASLSHAILEA
  LAAPDRAPFALLALRCACPEDARASPLPNEAWVALRRRHPGLAVELELEPALPAESVTRVLQPAVPVAAL
  RLNLSGDTVGPVRFAAHHYAATLCALEVRAAASAELNAALEELAARCAALREVHCFCVVSHSVLDAFRAH
  CPRLRTYTLKLTREPHPWRPTLVA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_060848
• RefSeq Size: 1618
• RefSeq ORF: 1122
• Synonyms: FBL8
• Locus ID: 55336
• UniProt ID: Q96CD0
• Cytogenetics: 16q22.1
• Summary: This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbls class. It shares 78% sequence identity with the mouse protein. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome