IGFBP6 (NM_002178) Human Mass Spec Standard

CAT#: PH304060

IGFBP6 MS Standard C13 and N15-labeled recombinant protein (NP_002169)

Product Images

Coomassie blue staining of purified IGFBP6 protein (Cat# TP304060). The protein was produced from HEK293T cells transfected with IGFBP6 cDNA clone (Cat# RC204060) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204060
• Predicted MW: 25.3 kDa
• Protein Sequence:
  Sequence Link

  >RC204060 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTPHRLLPPLLLLLALLLAASPGGALARCPGCGQGVQAGCPGGCVEEEDGGSPAEGCAEAEGCLRREGQE
  CGVYTPNCAPGLQCHPPKDDEAPLRALLLGRGRCLPARAPAVAEENPKESKPQAGTARPQDVNRRDQQRN
  PGTSTTPSQPNSAGVQDTEMGPCRRHLDSVLQQLQTEVYRGAQTLYVPNCDHRGFYRKRQCRSSQGQRRG
  PCWCVDRMGKSLPGSPDGNGSSSCPTGSSG
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002169
• RefSeq Size: 980
• RefSeq ORF: 720
• Synonyms: IBP6
• Locus ID: 3489
• UniProt ID: P24592
• Cytogenetics: 12q13.13
• Summary: IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors.[UniProtKB/Swiss-Prot Function]
• Protein Families: Secreted Protein