ESAM (NM_138961) Human Mass Spec Standard

CAT#: PH303885

ESAM MS Standard C13 and N15-labeled recombinant protein (NP_620411)

Product Images

Coomassie blue staining of purified ESAM protein (Cat# TP303885). The protein was produced from HEK293T cells transfected with ESAM cDNA clone (Cat# RC203885) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203885
• Predicted MW: 41.2 kDa
• Protein Sequence:
  Sequence Link

  >RC203885 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MISLPGPLVTNLLRFLFLGLSALAPPSRAQLQLHLPANRLQAVEGGEVVLPAWYTLHGEVSSSQPWEVPF
  VMWFFKQKEKEDQVLSYINGVTTSKPGVSLVYSMPSRNLSLRLEGLQEKDSGPYSCSVNVQDKQGKSRGH
  SIKTLELNVLVPPAPPSCRLQGVPHVGANVTLSCQSPRSKPAVQYQWDRQLPSFQTFFAPALDVIRGSLS
  LTNLSSSMAGVYVCKAHNEVGTAQCNVTLEVSTGPGAAVVAGAVVGTLVGLGLLAGLVLLYHRRGKALEE
  PANDIKEDAIAPRTLPWPKSSDTISKNGTLSSVTSARALRPPHGPPRPGALTPTPSLSSQALPSPRLPTT
  DGAHPQPISPIPGGVSSSGLSRMGAVPVMVPAQSQAGSLV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_620411
• RefSeq Size: 1869
• RefSeq ORF: 1170
• Synonyms: W117m
• Locus ID: 90952
• UniProt ID: Q96AP7
• Cytogenetics: 11q24.2
• Summary: Can mediate aggregation most likely through a homophilic molecular interaction.[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Cell adhesion molecules (CAMs), Leukocyte transendothelial migration