MAT1A (NM_000429) Human Mass Spec Standard
CAT#: PH303765
MAT1A MS Standard C13 and N15-labeled recombinant protein (NP_000420)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203765 |
Predicted MW | 43.6 kDa |
Protein Sequence |
>RC203765 protein sequence
Red=Cloning site Green=Tags(s) MNGPVDGLCDHSLSEGVFMFTSESVGEGHPDKICDQISDAVLDAHLKQDPNAKVACETVCKTGMVLLCGE ITSMAMVDYQRVVRDTIKHIGYDDSAKGFDFKTCNVLVALEQQSPDIAQCVHLDRNEEDVGAGDQGLMFG YATDETEECMPLTIILAHKLNARMADLRRSGLLPWLRPDSKTQVTVQYMQDNGAVIPVRIHTIVISVQHN EDITLEEMRRALKEQVIRAVVPAKYLDEDTVYHLQPSGRFVIGGPQGDAGVTGRKIIVDTYGGWGAHGGG AFSGKDYTKVDRSAAYAARWVAKSLVKAGLCRRVLVQVSYAIGVAEPLSISIFTYGTSQKTERELLDVVH KNFDLRPGVIVRDLDLKKPIYQKTACYGHFGRSEFPWEVPRKLVF myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_000420 |
RefSeq Size | 3419 |
RefSeq ORF | 1185 |
Synonyms | MAT; MATA1; SAMS; SAMS1 |
Locus ID | 4143 |
UniProt ID | Q00266 |
Cytogenetics | 10q22.3 |
Summary | This gene catalyzes a two-step reaction that involves the transfer of the adenosyl moiety of ATP to methionine to form S-adenosylmethionine and tripolyphosphate, which is subsequently cleaved to PPi and Pi. S-adenosylmethionine is the source of methyl groups for most biological methylations. The encoded protein is found as a homotetramer (MAT I) or a homodimer (MAT III) whereas a third form, MAT II (gamma), is encoded by the MAT2A gene. Mutations in this gene are associated with methionine adenosyltransferase deficiency. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Cysteine and methionine metabolism, Metabolic pathways, Selenoamino acid metabolism |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400152 | MAT1A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY400152 | Transient overexpression lysate of methionine adenosyltransferase I, alpha (MAT1A) |
USD 436.00 |
|
TP303765 | Recombinant protein of human methionine adenosyltransferase I, alpha (MAT1A), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review