Retinal protein 4 (UNC119) (NM_005148) Human Mass Spec Standard
CAT#: PH303758
UNC119 MS Standard C13 and N15-labeled recombinant protein (NP_005139)
USD 436.00
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203758 |
Predicted MW | 27 kDa |
Protein Sequence |
>RC203758 protein sequence
Red=Cloning site Green=Tags(s) MKVKKGGGGAGTATESAPGPSGQSVAPIPQPPAESESGSESEPDAGPGPRPGPLQRKQPIGPEDVLGLQR ITGDYLCSPEENIYKIDFVRFKIRDMDSGTVLFEIKKPPVSERLPINRRDLDPNAGRFVRYQFTPAFLRL RQVGATVEFTVGDKPVNNFRMIERHYFRNQLLKSFDFHFGFCIPSSKNTCEHIYDFPPLSEELISEMIRH PYETQSDSFYFVDDRLVMHNKADYSYSGTP myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_005139 |
RefSeq Size | 1398 |
RefSeq ORF | 720 |
Synonyms | HRG4; IMD13; POC7; POC7A |
Locus ID | 9094 |
UniProt ID | Q13432 |
Cytogenetics | 17q11.2 |
Summary | This gene is specifically expressed in the photoreceptors in the retina. The encoded product shares strong homology with the C. elegans unc119 protein and it can functionally complement the C. elegans unc119 mutation. It has been localized to the photoreceptor synapses in the outer plexiform layer of the retina, and suggested to play a role in the mechanism of photoreceptor neurotransmitter release through the synaptic vesicle cycle. Two transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Stem cell - Pluripotency |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409279 | UNC119 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC417490 | UNC119 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY409279 | Transient overexpression lysate of unc-119 homolog (C. elegans) (UNC119), transcript variant 2 |
USD 436.00 |
|
LY417490 | Transient overexpression lysate of unc-119 homolog (C. elegans) (UNC119), transcript variant 1 |
USD 436.00 |
|
PH312513 | UNC119 MS Standard C13 and N15-labeled recombinant protein (NP_473376) |
USD 3,255.00 |
|
TP303758 | Recombinant protein of human unc-119 homolog (C. elegans) (UNC119), transcript variant 1, 20 µg |
USD 867.00 |
|
TP312513 | Purified recombinant protein of Homo sapiens unc-119 homolog (C. elegans) (UNC119), transcript variant 2, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review