Retinal protein 4 (UNC119) (NM_005148) Human Mass Spec Standard

CAT#: PH303758

UNC119 MS Standard C13 and N15-labeled recombinant protein (NP_005139)

Product Images

Coomassie blue staining of purified UNC119 protein (Cat# TP303758). The protein was produced from HEK293T cells transfected with UNC119 cDNA clone (Cat# RC203758) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203758
• Predicted MW: 27 kDa
• Protein Sequence:
  Sequence Link

  >RC203758 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKVKKGGGGAGTATESAPGPSGQSVAPIPQPPAESESGSESEPDAGPGPRPGPLQRKQPIGPEDVLGLQR
  ITGDYLCSPEENIYKIDFVRFKIRDMDSGTVLFEIKKPPVSERLPINRRDLDPNAGRFVRYQFTPAFLRL
  RQVGATVEFTVGDKPVNNFRMIERHYFRNQLLKSFDFHFGFCIPSSKNTCEHIYDFPPLSEELISEMIRH
  PYETQSDSFYFVDDRLVMHNKADYSYSGTP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005139
• RefSeq Size: 1398
• RefSeq ORF: 720
• Synonyms: HRG4; IMD13; POC7; POC7A
• Locus ID: 9094
• UniProt ID: Q13432
• Cytogenetics: 17q11.2
• Summary: This gene is specifically expressed in the photoreceptors in the retina. The encoded product shares strong homology with the C. elegans unc119 protein and it can functionally complement the C. elegans unc119 mutation. It has been localized to the photoreceptor synapses in the outer plexiform layer of the retina, and suggested to play a role in the mechanism of photoreceptor neurotransmitter release through the synaptic vesicle cycle. Two transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Stem cell - Pluripotency