NUBP2 (NM_012225) Human Mass Spec Standard

CAT#: PH303571

NUBP2 MS Standard C13 and N15-labeled recombinant protein (NP_036357)

Product Images

Coomassie blue staining of purified NUBP2 protein (Cat# TP303571). The protein was produced from HEK293T cells transfected with NUBP2 cDNA clone (Cat# RC203571) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203571
• Predicted MW: 28.8 kDa
• Protein Sequence:
  Sequence Link

  >RC203571 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEAAAEPGNLAGVRHIILVLSGKGGVGKSTISTELALALRHAGKKVGILDVDLCGPSIPRMLGAQGRAVH
  QCDRGWAPVFLDREQSISLMSVGFLLEKPDEAVVWRGPKKNALIKQFVSDVAWGELDYLVVDTPPGTSDE
  HMATIEALRPYQPLGALVVTTPQAVSVGDVRRELTFCRKTGLRVMGIVENMSGFTCPHCTECTSVFSRGG
  GEELAQLAGVPFLGSVPLDPALMRTLEEGHDFIQEFPGSPAFAALTSIAQKILDATPACLP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_036357
• RefSeq Size: 1408
• RefSeq ORF: 813
• Synonyms: CFD1; CIAO6; NBP 2; NUBP1
• Locus ID: 10101
• UniProt ID: Q9Y5Y2, B7Z6P0
• Cytogenetics: 16p13.3
• Summary: This gene encodes an adenosine triphosphate (ATP) and metal-binding protein that is required for the assembly of cyotosolic iron-sulfur proteins. The encoded protein functions in a heterotetramer with nucleotide-binding protein 1 (NUBP1). Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2013]