RPP25 (NM_017793) Human Mass Spec Standard

CAT#: PH303538

RPP25 MS Standard C13 and N15-labeled recombinant protein (NP_060263)

Product Images

Coomassie blue staining of purified RPP25 protein (Cat# TP303538). The protein was produced from HEK293T cells transfected with RPP25 cDNA clone (Cat# RC203538) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203538
• Predicted MW: 20.6 kDa
• Protein Sequence:
  Sequence Link

  >RC203538 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MENFRKVRSEEAPAGCGAEGGGPGSGPFADLAPGAVHMRVKEGSKIRNLMAFATASMAQPATRAIVFSGC
  GRATTKTVTCAEILKRRLAGLHQVTRLRYRSVREVWQSLPPGPTQGQTPGEPAASLSVLKNVPGLAILLS
  KDALDPRQPGYQPPNPHPGPSSPPAAPASKRSLGEPAAGEGSAKRSQPEPGVADEDQTA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_060263
• RefSeq Size: 2333
• RefSeq ORF: 597
• Locus ID: 54913
• UniProt ID: Q9BUL9
• Cytogenetics: 15q24.2
• Summary: Component of ribonuclease P, a ribonucleoprotein complex that generates mature tRNA molecules by cleaving their 5'-ends (PubMed:12003489, PubMed:16723659, PubMed:30454648). Also a component of the MRP ribonuclease complex, which cleaves pre-rRNA sequences (PubMed:28115465).[UniProtKB/Swiss-Prot Function]