GAL3ST4 (NM_024637) Human Mass Spec Standard

CAT#: PH303401

GAL3ST4 MS Standard C13 and N15-labeled recombinant protein (NP_078913)

Product Images

Coomassie blue staining of purified GAL3ST4 protein (Cat# TP303401). The protein was produced from HEK293T cells transfected with GAL3ST4 cDNA clone (Cat# RC203401) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203401
• Predicted MW: 54.2 kDa
• Protein Sequence:
  Sequence Link

  >RC203401 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGPLSPARTLRLWGPRSLGVALGVFMTIGFALQLLGGPFQRRLPGLQLRQPSAPSLRPALPSCPPRQRLV
  FLKTHKSGSSSVLSLLHRYGDQHGLRFALPARYQFGYPKLFQASRVKGYRPQGGGTQLPFHILCHHMRFN
  LKEVLQVMPSDSFFFSIVRDPAALARSAFSYYKSTSSAFRKSPSLAAFLANPRGFYRPGARGDHYARNLL
  WFDFGLPFPPEKRAKRGNIHPPRDPNPPQLQVLPSGAGPRAQTLNPNALIHPVSTVTDHRSQISSPASFD
  LGSSSFIQWGLAWLDSVFDLVMVAEYFDESLVLLADALCWGLDDVVGFMHNAQAGHKQGLSTVSNSGLTA
  EDRQLTARARAWNNLDWALYVHFNRSLWARIEKYGQGRLQTAVAELRARREALAKHCLVGGEASDPKYIT
  DRRFRPFQFGSAKVLGYILRSGLSPQDQEECERLATPELQYKDKLDVKQFPPTVSLPLKTSRPLSP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_078913
• RefSeq Size: 2561
• RefSeq ORF: 1458
• Synonyms: GAL3ST-4
• Locus ID: 79690
• UniProt ID: Q96RP7
• Cytogenetics: 7q22.1
• Summary: This gene encodes a member of the galactose-3-O-sulfotransferase protein family. The product of this gene catalyzes sulfonation by transferring a sulfate to the C-3' position of galactose residues in O-linked glycoproteins. This enzyme is highly specific for core 1 structures, with asialofetuin, Gal-beta-1,3-GalNAc and Gal-beta-1,3 (GlcNAc-beta-1,6)GalNAc being good substrates. [provided by RefSeq, Jul 2008]
• Protein Families: Transmembrane