OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GAL3ST4 (NM_024637) Human Mass Spec Standard

Be the first to review this product
SKU
PH303401
GAL3ST4 MS Standard C13 and N15-labeled recombinant protein (NP_078913)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA376460 GAL3ST4 Rabbit polyclonal Antibody
100 ul
$410.00
LY411104 Transient overexpression lysate of galactose-3-O-sulfotransferase 4 (GAL3ST4) (as WB positive control) 100 ug
$436.00

Other products for "GAL3ST4 or NM_024637"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203401
Predicted MW 54.2 kDa
Protein Sequence
Protein Sequence
>RC203401 protein sequence
Red=Cloning site Green=Tags(s)

MGPLSPARTLRLWGPRSLGVALGVFMTIGFALQLLGGPFQRRLPGLQLRQPSAPSLRPALPSCPPRQRLV
FLKTHKSGSSSVLSLLHRYGDQHGLRFALPARYQFGYPKLFQASRVKGYRPQGGGTQLPFHILCHHMRFN
LKEVLQVMPSDSFFFSIVRDPAALARSAFSYYKSTSSAFRKSPSLAAFLANPRGFYRPGARGDHYARNLL
WFDFGLPFPPEKRAKRGNIHPPRDPNPPQLQVLPSGAGPRAQTLNPNALIHPVSTVTDHRSQISSPASFD
LGSSSFIQWGLAWLDSVFDLVMVAEYFDESLVLLADALCWGLDDVVGFMHNAQAGHKQGLSTVSNSGLTA
EDRQLTARARAWNNLDWALYVHFNRSLWARIEKYGQGRLQTAVAELRARREALAKHCLVGGEASDPKYIT
DRRFRPFQFGSAKVLGYILRSGLSPQDQEECERLATPELQYKDKLDVKQFPPTVSLPLKTSRPLSP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_078913
RefSeq Size 2561
RefSeq ORF 1458
Synonyms GAL3ST-4
Locus ID 79690
UniProt ID Q96RP7
Cytogenetics 7q22.1
Summary This gene encodes a member of the galactose-3-O-sulfotransferase protein family. The product of this gene catalyzes sulfonation by transferring a sulfate to the C-3' position of galactose residues in O-linked glycoproteins. This enzyme is highly specific for core 1 structures, with asialofetuin, Gal-beta-1,3-GalNAc and Gal-beta-1,3 (GlcNAc-beta-1,6)GalNAc being good substrates. provided by RefSeq, Jul 2008
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "GAL3ST4" proteins (3)
SKU Description Size Price
LC411104 Lyophilized GAL3ST4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411104 Transient overexpression lysate of galactose-3-O-sulfotransferase 4 (GAL3ST4) (as WB positive control) 100 ug
$436.00
TP303401 Recombinant protein of human galactose-3-O-sulfotransferase 4 (GAL3ST4), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products