LRRC39 (NM_144620) Human Mass Spec Standard

CAT#: PH303341

LRRC39 MS Standard C13 and N15-labeled recombinant protein (NP_653221)

Product Images

Coomassie blue staining of purified LRRC39 protein (Cat# TP303341). The protein was produced from HEK293T cells transfected with LRRC39 cDNA clone (Cat# RC203341) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203341
• Predicted MW: 38.8 kDa
• Protein Sequence:
  Sequence Link

  >RC203341 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTENVVCTGAVNAVKEVWEKRIKKLNEDLKREKEFQHKLVRIWEERVSLTKLREKVTREDGRVILKIEKE
  EWKTLPSSLLKLNQLQEWQLHRTGLLKIPEFIGRFQNLIVLDLSRNTISEIPPGIGLLTRLQELILSYNK
  IKTVPKELSNCASLEKLELAVNRDICDLPQELSNLLKLTHLDLSMNDFTTIPLAVLNMPALEWLDMGSNK
  LEQLPDTIERMQNLHTLWLQRNEITCLPQTISNMKNLGTLVLSNNKLQDIPVCMEEMANLRFVNFRDNPL
  KLKVSLPPSEGTDEEEERELFGLQFMHTYIQESRRRADHQVNGSTTLPISINTDG
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_653221
• RefSeq Size: 1865
• RefSeq ORF: 1005
• Locus ID: 127495
• UniProt ID: Q96DD0
• Cytogenetics: 1p21.2
• Summary: Component of the sarcomeric M-band which plays a role in myocyte response to biomechanical stress. May regulate expression of other M-band proteins via an SRF-dependent pathway. Important for normal contractile function in heart.[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome