TPMT (NM_000367) Human Mass Spec Standard

CAT#: PH303309

TPMT MS Standard C13 and N15-labeled recombinant protein (NP_000358)

Product Images

Coomassie blue staining of purified TPMT protein (Cat# TP303309). The protein was produced from HEK293T cells transfected with TPMT cDNA clone (Cat# RC203309) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203309
• Predicted MW: 28.2 kDa
• Protein Sequence:
  Sequence Link

  >RC203309 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDGTRTSLDIEEYSDTEVQKNQVLTLEEWQDKWVNGKTAFHQEQGHQLLKKHLDTFLKGKSGLRVFFPLC
  GKAVEMKWFADRGHSVVGVEISELGIQEFFTEQNLSYSEEPITEIPGTKVFKSSSGNISLYCCSIFDLPR
  TNIGKFDMIWDRGALVAINPGDRKCYADTMFSLLGKKFQYLLCVLSYDPTKHPGPPFYVPHAEIERLFGK
  ICNIRCLEKVDAFEERHKSWGIDCLFEKLYLLTEK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_000358
• RefSeq Size: 3281
• RefSeq ORF: 735
• Synonyms: TPMTD
• Locus ID: 7172
• UniProt ID: P51580, A0A024QZW0
• Cytogenetics: 6p22.3
• Summary: This gene encodes the enzyme that metabolizes thiopurine drugs via S-adenosyl-L-methionine as the S-methyl donor and S-adenosyl-L-homocysteine as a byproduct. Thiopurine drugs such as 6-mercaptopurine are used as chemotherapeutic agents. Genetic polymorphisms that affect this enzymatic activity are correlated with variations in sensitivity and toxicity to such drugs within individuals, causing thiopurine S-methyltransferase deficiency. Related pseudogenes have been identified on chromosomes 3, 18 and X. [provided by RefSeq, Aug 2014]
• Protein Families: Druggable Genome
• Protein Pathways: Drug metabolism - other enzymes