PBK (NM_018492) Human Mass Spec Standard

CAT#: PH303295

PBK MS Standard C13 and N15-labeled recombinant protein (NP_060962)

Product Images

Coomassie blue staining of purified PBK protein (Cat# TP303295). The protein was produced from HEK293T cells transfected with PBK cDNA clone (Cat# RC203295) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203295
• Predicted MW: 36.1 kDa
• Protein Sequence:
  Sequence Link

  >RC203295 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEGISNFKTPSKLSEKKKSVLCSTPTINIPASPFMQKLGFGTGVNVYLMKRSPRGLSHSPWAVKKINPIC
  NDHYRSVYQKRLMDEAKILKSLHHPNIVGYRAFTEANDGSLCLAMEYGGEKSLNDLIEERYKASQDPFPA
  AIILKVALNMARGLKYLHQEKKLLHGDIKSSNVVIKGDFETIKICDVGVSLPLDENMTVTDPEACYIGTE
  PWKPKEAVEENGVITDKADIFAFGLTLWEMMTLSIPHINLSNDDDDEDKTFDESDFDDEAYYAALGTRPP
  INMEELDESYQKVIELFSVCTNEDPKDRPSAAHIVEALETDV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_060962
• RefSeq Size: 2127
• RefSeq ORF: 966
• Synonyms: CT84; HEL164; Nori-3; SPK; TOPK
• Locus ID: 55872
• UniProt ID: Q96KB5, V9HWH0
• Cytogenetics: 8p21.1
• Summary: This gene encodes a serine/threonine protein kinase related to the dual specific mitogen-activated protein kinase kinase (MAPKK) family. Evidence suggests that mitotic phosphorylation is required for its catalytic activity. The encoded protein may be involved in the activation of lymphoid cells and support testicular functions, with a suggested role in the process of spermatogenesis. Overexpression of this gene has been implicated in tumorigenesis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]
• Protein Families: Druggable Genome, Protein Kinase