MHF2 (CENPX) (NM_144998) Human Mass Spec Standard

CAT#: PH303240

STRA13 MS Standard C13 and N15-labeled recombinant protein (NP_659435)

Product Images

Coomassie blue staining of purified CENPX protein (Cat# TP303240). The protein was produced from HEK293T cells transfected with CENPX cDNA clone (Cat# RC203240) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203240
• Predicted MW: 7 kDa
• Protein Sequence:
  Sequence Link

  >RC203240 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEGAGAGSGFRKELVSRLLHLHFKDDKTKEAAVRGVRQAQAEDALRADVDQLEKVLPQLLLDF
  
  TRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_659435
• RefSeq Size: 875
• RefSeq ORF: 189
• Synonyms: CENP-X; D9; FAAP10; MHF2; STRA13
• Locus ID: 201254
• UniProt ID: A8MT69
• Cytogenetics: 17q25.3
• Summary: DNA-binding component of the Fanconi anemia (FA) core complex. Required for the normal activation of the FA pathway, leading to monoubiquitination of the FANCI-FANCD2 complex in response to DNA damage, cellular resistance to DNA cross-linking drugs, and prevention of chromosomal breakage (PubMed:20347428, PubMed:20347429). In complex with CENPS (MHF heterodimer), crucial cofactor for FANCM in both binding and ATP-dependent remodeling of DNA. Stabilizes FANCM. In complex with CENPS and FANCM (but not other FANC proteins), rapidly recruited to blocked forks and promotes gene conversion at blocked replication forks (PubMed:20347428, PubMed:20347429). In complex with CENPS, CENPT and CENPW (CENP-T-W-S-X heterotetramer), involved in the formation of a functional kinetochore outer plate, which is essential for kinetochore-microtubule attachment and faithful mitotic progression (PubMed:19620631). As a component of MHF and CENP-T-W-S-X complexes, binds DNA and bends it to form a nucleosome-like structure (PubMed:20347428, PubMed:20347429). DNA-binding function is fulfilled in the presence of CENPS, with the following preference for DNA substates: Holliday junction > double-stranded > splay arm > single-stranded. Does not bind DNA on its own (PubMed:20347429).[UniProtKB/Swiss-Prot Function]