ZDH12 (ZDHHC12) (NM_032799) Human Mass Spec Standard

CAT#: PH303011

ZDHHC12 MS Standard C13 and N15-labeled recombinant protein (NP_116188)

Product Images

Coomassie blue staining of purified ZDHHC12 protein (Cat# TP303011). The protein was produced from HEK293T cells transfected with ZDHHC12 cDNA clone (Cat# RC203011) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203011
• Predicted MW: 30.6 kDa
• Protein Sequence:
  Sequence Link

  >RC203011 representing NM_032799
  Red=Cloning site Green=Tags(s)
  
  MAPWALLSPGVLVRTGHTVLTWGITLVLFLHDTELRQWEEQGELLLPLTFLLLVLGSLLLYLAVSLMDPG
  YVNVQPQPQEELKEEQTAMVPPAIPLRRCRYCLVLQPLRARHCRECRRCVRRYDHHCPWMENCVGERNHP
  LFVVYLALQLVVLLWGLYLAWSGLRFFQPWGLWLRSSGLLFATFLLLSLFSLVASLLLVSHLYLVASNTT
  TWEFISSHRIAYLRQRPSNPFDRGLTRNLAHFFCGWPSGSWETLWAEEEEEGSSPAV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_116188
• RefSeq Size: 1184
• RefSeq ORF: 801
• Synonyms: DHHC-12; ZNF400
• Locus ID: 84885
• UniProt ID: Q96GR4
• Cytogenetics: 9q34.11
• Summary: Palmitoyltransferase that could catalyze the addition of palmitate onto various protein substrates. Has a palmitoyltransferase activity toward gephyrin/GPHN, regulating its clustering at synapses and its function in gamma-aminobutyric acid receptor clustering. Thereby, indirectly regulates GABAergic synaptic transmission.[UniProtKB/Swiss-Prot Function]
• Protein Families: Transmembrane