ETEA (FAF2) (NM_014613) Human Mass Spec Standard

CAT#: PH302996

FAF2 MS Standard C13 and N15-labeled recombinant protein (NP_055428)

Product Images

Coomassie blue staining of purified FAF2 protein (Cat# TP302996). The protein was produced from HEK293T cells transfected with FAF2 cDNA clone (Cat# RC202996) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202996
• Predicted MW: 52.4 kDa
• Protein Sequence:
  Sequence Link

  >RC202996 representing NM_014613
  Red=Cloning site Green=Tags(s)
  
  MAAPEERDLTQEQTEKLLQFQDLTGIESMDQCRHTLEQHNWNIEAAVQDRLNEQEGVPSVFNPPPSRPLQ
  VNTADHRIYSYVVSRPQPRGLLGWGYYLIMLPFRFTYYTILDIFRFALRFIRPDPRSRVTDPVGDIVSFM
  HSFEEKYGRAHPVFYQGTYSQALNDAKRELRFLLVYLHGDDHQDSDEFCRNTLCAPEVISLINTRMLFWA
  CSTNKPEGYRVSQALRENTYPFLAMIMLKDRRMTVVGRLEGLIQPDDLINQLTFIMDANQTYLVSERLER
  EERNQTQVLRQQQDEAYLASLRADQEKERKKREERERKRRKEEEVQQQKLAEERRRQNLQEEKERKLECL
  PPEPSPDDPESVKIIFKLPNDSRVERRFHFSQSLTVIHDFLFSLKESPEKFQIEANFPRRVLPCIPSEEW
  PNPPTLQEAGLSHTEVLFVQDLTDE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_055428
• RefSeq Size: 4515
• RefSeq ORF: 1335
• Synonyms: ETEA; UBXD8; UBXN3B
• Locus ID: 23197
• UniProt ID: Q96CS3
• Cytogenetics: 5q35.2
• Summary: The protein encoded by this gene is highly expressed in peripheral blood of patients with atopic dermatitis (AD), compared to normal individuals. It may play a role in regulating the resistance to apoptosis that is observed in T cells and eosinophils of AD patients. [provided by RefSeq, Jul 2008]