LXN (NM_020169) Human Mass Spec Standard

CAT#: PH302769

LXN MS Standard C13 and N15-labeled recombinant protein (NP_064554)

Product Images

Coomassie blue staining of purified LXN protein (Cat# TP302769). The protein was produced from HEK293T cells transfected with LXN cDNA clone (Cat# RC202769) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202769
• Predicted MW: 25.8 kDa
• Protein Sequence:
  Sequence Link

  >RC202769 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEIPPTNYPASRAALVAQNYINYQQGTPHRVFEVQKVKQASMEDIPGRGHKYRLKFAVEEIIQKQVKVNC
  TAEVLYPSTGQETAPEVNFTFEGETGKNPDEEDNTFYQRLKSMKEPLEAQNIPDNFGNVSPEMTLVLHLA
  WVACGYIIWQNSTEDTWYKMVKIQTVKQVQRNDDFIELDYTILLHNIASQEIIPWQMQVLWHPQYGTKVK
  HNSRLPKEVQLE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_064554
• RefSeq Size: 1132
• RefSeq ORF: 666
• Synonyms: ECI; TCI
• Locus ID: 56925
• UniProt ID: Q9BS40
• Cytogenetics: 3q25.32
• Summary: This gene encodes the only known protein inhibitor of zinc-dependent metallocarboxypeptidases. The encoded protein, latexin, downregulates the population size of hematopoietic stem cells. This protein is found to be downregulated in cancer cells because of promoter hypermethylation. [provided by RefSeq, Jul 2020]