LXN (NM_020169) Human Tagged ORF Clone

CAT#: RC202769

LXN (Myc-DDK-tagged)-Human latexin (LXN)

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro

AAV Particle: DDK


  "NM_020169" in other vectors (7)

Reconstitution Protocol

Get a free Anti-DDK antibody sample free with this product. Use code: "DDK-Clone". View details »

USD 300.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


LXN mouse monoclonal antibody, clone OTI1E10 (formerly 1E10)
    • 100 ul

USD 447.00

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol LXN
Synonyms ECI; TCI
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC202769 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAAATCCCGCCGACCAACTACCCAGCCTCCAGGGCGGCCTTGGTGGCACAGAACTACATCAACTACC
AGCAGGGGACCCCGCACAGGGTGTTTGAGGTGCAGAAGGTCAAACAAGCCAGCATGGAGGATATTCCAGG
AAGAGGACATAAGTATCGCCTTAAATTTGCTGTTGAAGAAATTATACAAAAACAAGTTAAGGTGAACTGC
ACAGCTGAAGTACTTTACCCTTCAACGGGACAAGAAACTGCACCAGAAGTCAACTTCACATTTGAAGGAG
AAACTGGAAAGAATCCAGATGAAGAAGACAACACATTTTATCAAAGACTTAAGTCCATGAAGGAACCGCT
AGAAGCACAAAATATTCCAGACAATTTTGGAAATGTATCTCCAGAAATGACGCTCGTTCTACATTTAGCC
TGGGTTGCCTGTGGTTATATAATATGGCAAAATTCTACTGAAGACACATGGTATAAAATGGTAAAAATTC
AAACTGTCAAGCAAGTGCAAAGAAATGATGACTTTATTGAATTAGACTACACCATTCTACTTCATAATAT
AGCATCTCAGGAGATTATTCCCTGGCAAATGCAAGTTCTCTGGCATCCACAATACGGCACTAAAGTAAAA
CATAATAGCCGTCTGCCAAAGGAAGTACAACTGGAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC202769 protein sequence
Red=Cloning site Green=Tags(s)

MEIPPTNYPASRAALVAQNYINYQQGTPHRVFEVQKVKQASMEDIPGRGHKYRLKFAVEEIIQKQVKVNC
TAEVLYPSTGQETAPEVNFTFEGETGKNPDEEDNTFYQRLKSMKEPLEAQNIPDNFGNVSPEMTLVLHLA
WVACGYIIWQNSTEDTWYKMVKIQTVKQVQRNDDFIELDYTILLHNIASQEIIPWQMQVLWHPQYGTKVK
HNSRLPKEVQLE

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_020169
ORF Size 666 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_020169.2, NP_064554.2
RefSeq Size 1132 bp
RefSeq ORF 669 bp
Locus ID 56925
UniProt ID Q9BS40
Cytogenetics 3q25.32
MW 25.8 kDa
Gene Summary This gene encodes the only known protein inhibitor of zinc-dependent metallocarboxypeptidases. The encoded protein, latexin, downregulates the population size of hematopoietic stem cells. This protein is found to be downregulated in cancer cells because of promoter hypermethylation. [provided by RefSeq, Jul 2020]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.