CD69 (NM_001781) Human Mass Spec Standard
CAT#: PH302756
CD69 MS Standard C13 and N15-labeled recombinant protein (NP_001772)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202756 |
Predicted MW | 22.6 kDa |
Protein Sequence |
>RC202756 protein sequence
Red=Cloning site Green=Tags(s) MSSENCFVAENSSLHPESGQENDATSPHFSTRHEGSFQVPVLCAVMNVVFITILIIALIALSVGQYNCPG QYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREE HWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTEVSSMECEKNLYWICNKPYK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001772 |
RefSeq Size | 1676 |
RefSeq ORF | 597 |
Synonyms | AIM; BL-AC/P26; CLEC2C; EA1; GP32/28; MLR-3 |
Locus ID | 969 |
UniProt ID | Q07108, Q53ZX0 |
Cytogenetics | 12p13.31 |
Summary | This gene encodes a member of the calcium dependent lectin superfamily of type II transmembrane receptors. Expression of the encoded protein is induced upon activation of T lymphocytes, and may play a role in proliferation. Furthermore, the protein may act to transmit signals in natural killer cells and platelets. [provided by RefSeq, Aug 2011] |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400672 | CD69 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY400672 | Transient overexpression lysate of CD69 molecule (CD69), transcript variant 1 |
USD 436.00 |
|
TP302756 | Recombinant protein of human CD69 molecule (CD69), transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review