MSMB (NM_002443) Human Mass Spec Standard
CAT#: PH302704
MSMB MS Standard C13 and N15-labeled recombinant protein (NP_002434)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202704 |
Predicted MW | 12.9 kDa |
Protein Sequence |
>RC202704 protein sequence
Red=Cloning site Green=Tags(s) MNVLLGSVVIFATFVTLCNASCYFIPNEGVPGDSTRKCMDLKGNKHPINSEWQTDNCETCTCYETEISCC TLVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPKKTCSVSEWII myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_002434 |
RefSeq Size | 503 |
RefSeq ORF | 342 |
Synonyms | HPC13; IGBF; MSP; MSPB; PN44; PRPS; PSP; PSP-94; PSP57; PSP94 |
Locus ID | 4477 |
UniProt ID | P08118 |
Cytogenetics | 10q11.22 |
Summary | The protein encoded by this gene is a member of the immunoglobulin binding factor family. It is synthesized by the epithelial cells of the prostate gland and secreted into the seminal plasma. This protein has inhibin-like activity. It may have a role as an autocrine paracrine factor in uterine, breast and other female reproductive tissues. The expression of the encoded protein is found to be decreased in prostate cancer. Two alternatively spliced transcript variants encoding different isoforms are described for this gene. The use of alternate polyadenylation sites has been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Secreted Protein, Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400872 | MSMB HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY400872 | Transient overexpression lysate of microseminoprotein, beta- (MSMB), transcript variant PSP94 |
USD 436.00 |
|
TP302704 | Recombinant protein of human microseminoprotein, beta- (MSMB), transcript variant PSP94, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review