EIF1B (NM_005875) Human Mass Spec Standard
CAT#: PH302691
EIF1B MS Standard C13 and N15-labeled recombinant protein (NP_005866)
USD 436.00
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202691 |
Predicted MW | 12.8 kDa |
Protein Sequence |
>RC202691 protein sequence
Red=Cloning site Green=Tags(s) MSTIQNLQSFDPFADATKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACN GTVIEHPEYGEVIQLQGDQRKNICQFLLEVGIVKEEQLKVHGF myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_005866 |
RefSeq Size | 1014 |
RefSeq ORF | 339 |
Synonyms | GC20 |
Locus ID | 10289 |
UniProt ID | O60739, Q6FG85 |
Cytogenetics | 3p22.1 |
Summary | Probably involved in translation.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416997 | EIF1B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY416997 | Transient overexpression lysate of eukaryotic translation initiation factor 1B (EIF1B) |
USD 436.00 |
|
TP302691 | Recombinant protein of human eukaryotic translation initiation factor 1B (EIF1B), 20 µg |
USD 867.00 |
|
TP720195 | Recombinant protein of human eukaryotic translation initiation factor 1B (EIF1B) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review