RPRM (NM_019845) Human Mass Spec Standard
CAT#: PH302634
RPRM MS Standard C13 and N15-labeled recombinant protein (NP_062819)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202634 |
Predicted MW | 11.8 kDa |
Protein Sequence |
>RC202634 protein sequence
Red=Cloning site Green=Tags(s) MNPALGNQTDVAGLFLANSSEALERAVRCCTQASVVTDDGFAEGGPDERSLYIMRVVQIAVMCVLSLTVV FGIFFLGCNLLIKSEGMINFLVKDRRPSKEVEAVVVGPY myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_062819 |
RefSeq Size | 1496 |
RefSeq ORF | 327 |
Synonyms | REPRIMO |
Locus ID | 56475 |
UniProt ID | Q9NS64 |
Cytogenetics | 2q23.3 |
Summary | May be involved in the regulation of p53-dependent G2 arrest of the cell cycle. Seems to induce cell cycle arrest by inhibiting CDK1 activity and nuclear translocation of the CDC2 cyclin B1 complex (By similarity).[UniProtKB/Swiss-Prot Function] |
Protein Families | Transmembrane |
Protein Pathways | p53 signaling pathway |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412715 | RPRM HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY412715 | Transient overexpression lysate of reprimo, TP53 dependent G2 arrest mediator candidate (RPRM) |
USD 436.00 |
|
TP302634 | Recombinant protein of human reprimo, TP53 dependent G2 arrest mediator candidate (RPRM), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review