Apolipoprotein L 2 (APOL2) (NM_030882) Human Mass Spec Standard
CAT#: PH302585
APOL2 MS Standard C13 and N15-labeled recombinant protein (NP_112092)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202585 |
Predicted MW | 37.1 kDa |
Protein Sequence |
>RC202585 protein sequence
Red=Cloning site Green=Tags(s) MNPESSIFIEDYLKYFQDQVSRENLLQLLTDDEAWNGFVAAAELPRDEADELRKALNKLASHMVMKDKNR HDKDQQHRQWFLKEFPRLKRELEDHIRKLRALAEEVEQVHRGTTIANVVSNSVGTTSGILTLLGLGLAPF TEGISFVLLDTGMGLGAAAAVAGITCSVVELVNKLRARAQARNLDQSGTNVAKVMKEFVGGNTPNVLTLV DNWYQVTQGIGRNIRAIRRARANPQLGAYAPPPHVIGRISAEGGEQVERVVEGPAQAMSRGTMIVGAATG GILLLLDVVSLAYESKHLLEGAKSESAEELKKRAQELEGKLNFLTKIHEMLQPGQDQ myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_112092 |
RefSeq Size | 2545 |
RefSeq ORF | 1011 |
Synonyms | APOL-II; APOL3 |
Locus ID | 23780 |
UniProt ID | Q9BQE5, A0A024R1M8 |
Cytogenetics | 22q12.3 |
Summary | This gene is a member of the apolipoprotein L gene family. The encoded protein is found in the cytoplasm, where it may affect the movement of lipids or allow the binding of lipids to organelles. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403087 | APOL2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC407937 | APOL2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY403087 | Transient overexpression lysate of apolipoprotein L, 2 (APOL2), transcript variant alpha |
USD 436.00 |
|
LY407937 | Transient overexpression lysate of apolipoprotein L, 2 (APOL2), transcript variant beta |
USD 436.00 |
|
PH316858 | APOL2 MS Standard C13 and N15-labeled recombinant protein (NP_663612) |
USD 3,255.00 |
|
TP302585 | Recombinant protein of human apolipoprotein L, 2 (APOL2), transcript variant alpha, 20 µg |
USD 867.00 |
|
TP316858 | Recombinant protein of human apolipoprotein L, 2 (APOL2), transcript variant beta, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review