PAG608 (ZMAT3) (NM_022470) Human Mass Spec Standard

CAT#: PH302508

ZMAT3 MS Standard C13 and N15-labeled recombinant protein (NP_071915)

Product Images

Coomassie blue staining of purified ZMAT3 protein (Cat# TP302508). The protein was produced from HEK293T cells transfected with ZMAT3 cDNA clone (Cat# RC202508) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202508
• Predicted MW: 32.1 kDa
• Protein Sequence:
  Sequence Link

  >RC202508 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MILLQHAVLPPPKQPSPSPPMSVATRSTGTLQLPPQKPFGQEASLPLAGEEELSKGGEQDCALEELCKPL
  YCKLCNVTLNSAQQAQAHYQGKNHGKKLRNYYAANSCPPPARMSNVVEPAATPVVPVPPQMGSFKPGGRV
  ILATENDYCKLCDASFSSPAVAQAHYQGKNHAKRLRLAEAQSNSFSESSELGQRRARKEGNEFKMMPNRR
  NMYTVQNNSAGPYFNPRSRQRIPRDLAMCVTPSGQFYCSMCNVGAGEEMEFRQHLESKQHKSKVSEQRYR
  NEMENLGYV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_071915
• RefSeq Size: 8995
• RefSeq ORF: 867
• Synonyms: PAG608; WIG-1; WIG1
• Locus ID: 64393
• UniProt ID: Q9HA38
• Cytogenetics: 3q26.32
• Summary: This gene encodes a protein containing three zinc finger domains and a nuclear localization signal. The mRNA and the protein of this gene are upregulated by wildtype p53 and overexpression of this gene inhibits tumor cell growth, suggesting that this gene may have a role in the p53-dependent growth regulatory pathway. Alternative splicing of this gene results in two transcript variants encoding two isoforms differing in only one amino acid. [provided by RefSeq, Jul 2008]
• Protein Families: Transcription Factors
• Protein Pathways: p53 signaling pathway