RGS16 (NM_002928) Human Mass Spec Standard
CAT#: PH302430
RGS16 MS Standard C13 and N15-labeled recombinant protein (NP_002919)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202430 |
Predicted MW | 22.8 kDa |
Protein Sequence |
>RC202430 protein sequence
Red=Cloning site Green=Tags(s) MCRTLAAFPTTCLERAKEFKTRLGIFLHKSELGCDTGSTGKFEWGSKHSKENRNFSEDVLGWRESFDLLL SSKNGVAAFHAFLKTEFSEENLEFWLACEEFKKIRSATKLASRAHQIFEEFICSEAPKEVNIDHETRELT RMNLQTATATCFDAAQGKTRTLMEKDSYPRFLKSPAYRDLAAQASAASATLSSCSLDEPSHT myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_002919 |
RefSeq Size | 2432 |
RefSeq ORF | 606 |
Synonyms | A28-RGS14; A28-RGS14P; RGS-R |
Locus ID | 6004 |
UniProt ID | O15492 |
Cytogenetics | 1q25.3 |
Summary | The protein encoded by this gene belongs to the 'regulator of G protein signaling' family. It inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits. It also may play a role in regulating the kinetics of signaling in the phototransduction cascade. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419009 | RGS16 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY419009 | Transient overexpression lysate of regulator of G-protein signaling 16 (RGS16) |
USD 436.00 |
|
TP302430 | Recombinant protein of human regulator of G-protein signaling 16 (RGS16), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review