RGS16 (NM_002928) Human Mass Spec Standard

CAT#: PH302430

RGS16 MS Standard C13 and N15-labeled recombinant protein (NP_002919)

Product Images

Coomassie blue staining of purified RGS16 protein (Cat# TP302430). The protein was produced from HEK293T cells transfected with RGS16 cDNA clone (Cat# RC202430) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202430
• Predicted MW: 22.8 kDa
• Protein Sequence:
  Sequence Link

  >RC202430 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MCRTLAAFPTTCLERAKEFKTRLGIFLHKSELGCDTGSTGKFEWGSKHSKENRNFSEDVLGWRESFDLLL
  SSKNGVAAFHAFLKTEFSEENLEFWLACEEFKKIRSATKLASRAHQIFEEFICSEAPKEVNIDHETRELT
  RMNLQTATATCFDAAQGKTRTLMEKDSYPRFLKSPAYRDLAAQASAASATLSSCSLDEPSHT
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002919
• RefSeq Size: 2432
• RefSeq ORF: 606
• Synonyms: A28-RGS14; A28-RGS14P; RGS-R
• Locus ID: 6004
• UniProt ID: O15492
• Cytogenetics: 1q25.3
• Summary: The protein encoded by this gene belongs to the 'regulator of G protein signaling' family. It inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits. It also may play a role in regulating the kinetics of signaling in the phototransduction cascade. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome