C9orf156 (TRMO) (NM_016481) Human Mass Spec Standard

CAT#: PH302401

C9orf156 MS Standard C13 and N15-labeled recombinant protein (NP_057565)

Product Images

Coomassie blue staining of purified TRMO protein (Cat# TP302401). The protein was produced from HEK293T cells transfected with TRMO cDNA clone (Cat# RC202401) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202401
• Predicted MW: 48.6 kDa
• Protein Sequence:
  Sequence Link

  >RC202401 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRGLEEPGPRPTATPCGCVKPALETGNLLTEPVGYLESCFSAKNGTPRQPSICSYSRACLRIRKRIFNNP
  EHSLMGLEQFSHVWILFVFHKNGHLSCKAKVQPPRLNGAKTGVFSTRSPHRPNAIGLTLAKLEKVEGGAI
  YLSGIDMIHGTPVLDIKPYIAEYDSPQNVMEPLADFNLQNNQHTPNTVSQSDSKTDSCDQRQLSGCDEPQ
  PHHSTKRKPKCPEDRTSEENYLTHSDTARIQQAFPMHREIAVDFGLESRRDQSSSVAEEQIGPYCPEKSF
  SEKGTDKKLERVEGAAVLQGSRAETQPMAPHCPAGRADGAPRSVVPAWVTEAPVATLEVRFTPHAEMDLG
  QLSSQDVGQASFKYFQSAEEAKRAIEAVLSADPRSVYRRKLCQDRLFYFTVDIAHVTCWFGDGFAEVLRI
  KPASEPVHMTGPVGSLVSLGS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057565
• RefSeq Size: 1664
• RefSeq ORF: 1323
• Synonyms: C9orf156; HSPC219; NAP1
• Locus ID: 51531
• UniProt ID: Q9BU70
• Cytogenetics: 9q22.33
• Summary: S-adenosyl-L-methionine-dependent methyltransferase responsible for the addition of the methyl group in the formation of N6-methyl-N6-threonylcarbamoyladenosine at position 37 (m(6)t(6)A37) of the tRNA anticodon loop of tRNA(Ser)(GCU) (PubMed:25063302). The methyl group of m(6)t(6)A37 may improve the efficiency of the tRNA decoding ability. May bind to tRNA (By similarity).[UniProtKB/Swiss-Prot Function]