SEPTIN10 (NM_144710) Human Mass Spec Standard

CAT#: PH302381

SEPT10 MS Standard C13 and N15-labeled recombinant protein (NP_653311)

Product Images

Coomassie blue staining of purified SEPTIN10 protein (Cat# TP302381). The protein was produced from HEK293T cells transfected with SEPTIN10 cDNA clone (Cat# RC202381) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202381
• Predicted MW: 52.6 kDa
• Protein Sequence:
  Sequence Link

  >RC202381 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASSEVARHLLFQSHMATKTTCMSSQGSDDEQIKRENIRSLTMSGHVGFESLPDQLVNRSIQQGFCFNIL
  CVGETGIGKSTLIDTLFNTNFEDYESSHFCPNVKLKAQTYELQESNVQLKLTIVNTVGFGDQINKEESYQ
  PIVDYIDAQFEAYLQEELKIKRSLFTYHDSRIHVCLYFISPTGHSLKTLDLLTMKNLDSKVNIIPVIAKA
  DTVSKTELQKFKIKLMSELVSNGVQIYQFPTDDDTIAKVNAAMNGQLPFAVVGSMDEVKVGNKMVKARQY
  PWGVVQVENENHCDFVKLREMLICTNMEDLREQTHTRHYELYRRCKLEEMGFTDVGPENKPVSVQETYEA
  KRHEFHGERQRKEEEMKQMFVQRVKEKEAILKEAERELQAKFEHLKRLHQEERMKLEEKRRLLEEEIIAF
  SKKKATSEIFHSQSFLATGSNLRKDKDRKNSNFL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_653311
• RefSeq Size: 3256
• RefSeq ORF: 1362
• Synonyms: SEPT10
• Locus ID: 151011
• UniProt ID: Q9P0V9, Q59H84
• Cytogenetics: 2q13
• Summary: This gene encodes a member of the septin family of cytoskeletal proteins with GTPase activity. This protein localizes to the cytoplasm and nucleus and displays GTP-binding and GTPase activity. A pseudogene for this gene is located on chromosome 8. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2012]