FAM241B (NM_145306) Human Mass Spec Standard
CAT#: PH302250
C10orf35 MS Standard C13 and N15-labeled recombinant protein (NP_660349)
USD 436.00
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202250 |
Predicted MW | 13.2 kDa |
Protein Sequence |
>RC202250 protein sequence
Red=Cloning site Green=Tags(s) MVRILANGEIVQDDDPRVRTTTQPPRGSIPRQSFFNRGHGAPPGGPGPRQQQAGARLGAAQSPFNDLNRQ LVNMGFPQWHLGNHAVEPVTSILLLFLLMMLGVRGLLLVGLVYLVSHLSQR myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_660349 |
RefSeq Size | 1092 |
RefSeq ORF | 363 |
Synonyms | C10orf35 |
Locus ID | 219738 |
UniProt ID | Q96D05, A0A024QZL0 |
Cytogenetics | 10q22.1 |
Summary | May play a role in lysosome homeostasis.[UniProtKB/Swiss-Prot Function] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407955 | C10orf35 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY407955 | Transient overexpression lysate of chromosome 10 open reading frame 35 (C10orf35) |
USD 436.00 |
|
TP302250 | Recombinant protein of human chromosome 10 open reading frame 35 (C10orf35), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review