RAB38 (NM_022337) Human Mass Spec Standard
CAT#: PH302196
RAB38 MS Standard C13 and N15-labeled recombinant protein (NP_071732)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202196 |
Predicted MW | 23.7 kDa |
Protein Sequence |
>RC202196 protein sequence
Red=Cloning site Green=Tags(s) MQAPHKEHLYKLLVIGDLGVGKTSIIKRYVHQNFSSHYRATIGVDFALKVLHWDPETVVRLQLWDIAGQE RFGNMTRVYYREAMGAFIVFDVTRPATFEAVAKWKNDLDSKLSLPNGKPVSVVLLANKCDQGKDVLMNNG LKMDQFCKEHGFVGWFETSAKENINIDEASRCLVKHILANECDLMESIEPDVVKPHLTSTKVASCSGCAK S myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_071732 |
RefSeq Size | 1479 |
RefSeq ORF | 633 |
Synonyms | NY-MEL-1; rrGTPbp |
Locus ID | 23682 |
UniProt ID | P57729, A0A024R191 |
Cytogenetics | 11q14.2 |
Summary | May be involved in melanosomal transport and docking. Involved in the proper sorting of TYRP1. Involved in peripheral melanosomal distribution of TYRP1 in melanocytes; the function, which probably is implicating vesicle-trafficking, includes cooperation with ANKRD27 and VAMP7 (By similarity). Plays a role in the maturation of phagosomes that engulf pathogens, such as S.aureus and M.tuberculosis (PubMed:21255211). Plays an important role in the control of melanin production and melanosome biogenesis (PubMed:23084991). In concert with RAB32, regulates the proper trafficking of melanogenic enzymes TYR, TYRP1 and DCT/TYRP2 to melanosomes in melanocytes (By similarity).[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411709 | RAB38 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY411709 | Transient overexpression lysate of RAB38, member RAS oncogene family (RAB38) |
USD 436.00 |
|
TP302196 | Recombinant protein of human RAB38, member RAS oncogene family (RAB38), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review